![Immunohistochemistry-Paraffin: ACSS1 Antibody [NBP2-30635] - Staining in human placenta and liver tissues using anti-ACSS1 antibody. Corresponding ACSS1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/ACSS1-Antibody-Immunohistochemistry-Paraffin-NBP2-30635-img0006.jpg "Immunohistochemistry-Paraffin: ACSS1 Antibody [NBP2-30635] - Staining in human placenta and liver tissues using anti-ACSS1 antibody. Corresponding ACSS1 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: AQPGSYPALSAQAAREPAAFWGPLARDTLVWDTPYHTVWDCDFSTGKIGWFLGGQLNVSVNCLDQHVRKSPESVALIWERDEPGTEVRITYRELLETT |
| Predicted Species | Rat (93%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ACSS1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP2-30635 | Applications | Species |
|---|---|---|
| Schug ZT, Peck B, Jones DT et al. Acetyl-CoA Synthetase 2 Promotes Acetate Utilization and Maintains Cancer Cell Growth under Metabolic Stress. Cancer Cell 2015-01-12 [PMID: 25584894] (IF/IHC, Mouse) | IF/IHC | Mouse |
Secondary Antibodies |
Isotype Controls |
Research Areas for ACSS1 Antibody (NBP2-30635)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: ACSS1 Antibody [NBP2-30635] - Analysis in human cell line RPMI-8226.](http://images.novusbio.com/fullsize/ACSS1-Antibody-Western-Blot-NBP2-30635-img0008.jpg "Western Blot: ACSS1 Antibody [NBP2-30635] - Analysis in human cell line RPMI-8226.")
![Immunohistochemistry-Paraffin: ACSS1 Antibody [NBP2-30635] - Immunohistochemical staining of human upper duodenum shows moderate granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/ACSS1-Antibody-Immunohistochemistry-NBP2-30635-img0010.jpg "Immunohistochemistry-Paraffin: ACSS1 Antibody [NBP2-30635] - Immunohistochemical staining of human upper duodenum shows moderate granular cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: ACSS1 Antibody [NBP2-30635] - Staining of human liver shows low expression as expected.](http://images.novusbio.com/fullsize/ACSS1-Antibody-Immunohistochemistry-Paraffin-NBP2-30635-img0004.jpg "Immunohistochemistry-Paraffin: ACSS1 Antibody [NBP2-30635] - Staining of human liver shows low expression as expected.")
![Immunohistochemistry-Paraffin: ACSS1 Antibody [NBP2-30635] - Staining of human placenta shows high expression.](http://images.novusbio.com/fullsize/ACSS1-Antibody-Immunohistochemistry-Paraffin-NBP2-30635-img0005.jpg "Immunohistochemistry-Paraffin: ACSS1 Antibody [NBP2-30635] - Staining of human placenta shows high expression.")
![Immunohistochemistry-Paraffin: ACSS1 Antibody [NBP2-30635] - Immunohistochemical staining of human testis shows moderate granular cytoplasmic positivity in Leydig cells.](http://images.novusbio.com/fullsize/ACSS1-Antibody-Immunohistochemistry-NBP2-30635-img0009.jpg "Immunohistochemistry-Paraffin: ACSS1 Antibody [NBP2-30635] - Immunohistochemical staining of human testis shows moderate granular cytoplasmic positivity in Leydig cells.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")