NCOA3/AIB1 Recombinant Protein Antigen Summary
Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NCOA3. Source: E. coli
Amino Acid Sequence: PSKVSNQDSKSPLGFYCDQNPVESSMCQSNSRDHLSDKESKESSVEGAENQRGPLESKGHKKLLQLLTCSSDDRGHSSLTNSPLDSSCKESSVSVTSPSGVSSSTSGGVSSTSNMHGSLLQEKHRILHKLL Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
Source |
E. coli |
Protein/Peptide Type |
Recombinant Protein Antigen |
Gene |
NCOA3 |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
Dilutions |
- Antibody Competition 10 - 100 molar excess
|
Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90256. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
Theoretical MW |
32 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS and 1M Urea, pH 7.4. |
Preservative |
No Preservative |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for NCOA3/AIB1 Recombinant Protein Antigen
Background
NCOA3/SRC3 (nuclear receptor coactivator 3/steroid receptor coactivator 3 (SRC3)) is a 155 kD member of the p160/steroid receptor coactivator family containing a nuclear localization sequence, bHLH, and PAS domain. There are two reported isoforms of this protein. NCOA3/SRC3 is localized mainly in the cytoplasm, with weak nuclear expression. The protein is translocated to the nucleus upon phosphorylation. NCOA3/SRC3 is widely expressed with high expression in the heart, skeletal muscle, pancreas, and placenta and low expression in the brain. NCOA3/SRC3 is expressed at very low levels in the lung, liver, and kidney and overexpressed in breast and ovarian cancers. This protein has histone acetyltransferase activity and functions as a transcriptional coactivator for steroid and nuclear hormone receptors. Phosphorylation by I kappaB kinase enhances coactivator function. Acetylation by CREB-BP disrupts interaction with nuclear receptors. NCOA3/SRC3 forms a multisubunit coactivation complex with NCOA2 IKKA, IKKB, IKBKG and histone acetyltransferase protein CREB binding protein and has also been shown to interact with PCAF.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Pm, Mu, Rt
Applications: ChIP, IP, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm, Mu, Rt
Applications: ChIP, IP, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, IP, PLA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, KD, WB
Species: Hu
Applications: ELISA, ICC/IF, IP, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu, Mu
Applications: WB
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: AC
Publications for NCOA3/AIB1 Protein (NBP1-90256PEP) (0)
There are no publications for NCOA3/AIB1 Protein (NBP1-90256PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for NCOA3/AIB1 Protein (NBP1-90256PEP) (0)
There are no reviews for NCOA3/AIB1 Protein (NBP1-90256PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for NCOA3/AIB1 Protein (NBP1-90256PEP) (0)
Additional NCOA3/AIB1 Products
Research Areas for NCOA3/AIB1 Protein (NBP1-90256PEP)
Find related products by research area.
|
Blogs on NCOA3/AIB1