![Western Blot: WNK3 Antibody [NBP2-93100] - Analysis of HAP1, using WNK3 antibody at 1:540 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 90s.](http://images.novusbio.com/fullsize/WNK3-Antibody-Western-Blot-NBP2-93100-img0005.jpg "Western Blot: WNK3 Antibody [NBP2-93100] - Analysis of HAP1, using WNK3 antibody at 1:540 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 90s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 500-600 of human WNK3 (NP_065973.2). AGCLEERRDSQCKSMGNVFPQPQNTTLPLAPAQQTGAECEETEVDQHVRQQLLQRKPQQHCSSVTGDNLSEAGAASVIHSDTSSQPSVAYSSNQTMGSQMV |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | WNK3 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for WNK3 Antibody (NBP2-93100)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | WNK3 |
![Immunocytochemistry/Immunofluorescence: WNK3 Antibody [NBP2-93100] - Immunofluorescence analysis of U2OS cells using WNK3 Rabbit pAb (NBP2-93100) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/WNK3-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-93100-img0004.jpg "Immunocytochemistry/Immunofluorescence: WNK3 Antibody [NBP2-93100] - Immunofluorescence analysis of U2OS cells using WNK3 Rabbit pAb (NBP2-93100) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.")
![Immunocytochemistry/Immunofluorescence: WNK3 Antibody [NBP2-93100] - Immunofluorescence analysis of NIH/3T3 cells using WNK3 Rabbit pAb (NBP2-93100) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/WNK3-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-93100-img0002.jpg "Immunocytochemistry/Immunofluorescence: WNK3 Antibody [NBP2-93100] - Immunofluorescence analysis of NIH/3T3 cells using WNK3 Rabbit pAb (NBP2-93100) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.")
![Immunocytochemistry/Immunofluorescence: WNK3 Antibody [NBP2-93100] - Immunofluorescence analysis of PC-12 cells using WNK3 Rabbit pAb (NBP2-93100) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/WNK3-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-93100-img0003.jpg "Immunocytochemistry/Immunofluorescence: WNK3 Antibody [NBP2-93100] - Immunofluorescence analysis of PC-12 cells using WNK3 Rabbit pAb (NBP2-93100) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.")
![Western Blot WNK1 Antibody [Unconjugated]](https://images.novusbio.com/images2/WNK1_AF2849_Western_Blot_5218.jpg)
![Flow Cytometry KCC4/SLC12A7 Antibody (891526) [Unconjugated]](https://images.novusbio.com/images2/KCC4_MAB9030_Flow_Cytometry_19166.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")