![Immunohistochemistry-Paraffin: NKCC2/SLC12A1 Antibody [NBP1-80993] - Analysis in human kidney and pancreas tissues using NBP1-80993 antibody. Corresponding SLC12A1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/NKCC2-SLC12A1-Antibody-Immunohistochemistry-Paraffin-NBP1-80993-img0018.jpg "Immunohistochemistry-Paraffin: NKCC2/SLC12A1 Antibody [NBP1-80993] - Analysis in human kidney and pancreas tissues using NBP1-80993 antibody. Corresponding SLC12A1 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MSLNNSSNVFLDSVPSNTNRFQVSVINENHESSAAADDNTDPPHYEETSFGDEAQKRLRISFRPGNQECYDNFLQSGETAKTDASFHAYDSHTNTYYLQTFGHNTMDAVPKIEYYRNTGSI |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLC12A1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry Neurophysin II/Arg-vasopressin Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af009_human-neurophysin-ii-affinity-purified-polyclonal-ab-immunohistochemistry-2812202013195.jpg)
| Publication using NBP1-80993 | Applications | Species |
|---|---|---|
| Schrodter S, Braun M, Syring I et al. Identification of the dopamine transporter SLC6A3 as a biomarker for patients with renal cell carcinoma Mol. Cancer 2016-02-02 [PMID: 26831905] (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for NKCC2/SLC12A1 Antibody (NBP1-80993)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: NKCC2/SLC12A1 Antibody [NBP1-80993] - Staining of human cerebellum, kidney, liver and pancreas using Anti-SLC12A1 antibody NBP1-80993 (A) shows similar protein distribution across tissues to independent antibody NBP1-82559 (B).](http://images.novusbio.com/fullsize/NKCC2-SLC12A1-Antibody-Immunohistochemistry-Paraffin-NBP1-80993-img0013.jpg "Immunohistochemistry-Paraffin: NKCC2/SLC12A1 Antibody [NBP1-80993] - Staining of human cerebellum, kidney, liver and pancreas using Anti-SLC12A1 antibody NBP1-80993 (A) shows similar protein distribution across tissues to independent antibody NBP1-82559 (B).")
![Western Blot: NKCC2/SLC12A1 Antibody [NBP1-80993] - Western blot experiments were performed to determine the protein expression in eight corresponding normal (N) and clear cell renal cell carcinoma (T) tissue. NPTX2 was increased in tumor tissue, whereas FXYD4, KNG1, SLC12A1 and SLC6A3 were decreased in tumors. NDUF4AL2 levels were similar, but the bands were of different size in tumor and normal samples Image collected and cropped by CiteAb from the following publication (//molecular-cancer.biomedcentral.com/articles/10.1186/s12943-016-0495-5), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/NKCC2-SLC12A1-Antibody-Western-Blot-NBP1-80993-img0011.jpg "Western Blot: NKCC2/SLC12A1 Antibody [NBP1-80993] - Western blot experiments were performed to determine the protein expression in eight corresponding normal (N) and clear cell renal cell carcinoma (T) tissue. NPTX2 was increased in tumor tissue, whereas FXYD4, KNG1, SLC12A1 and SLC6A3 were decreased in tumors. NDUF4AL2 levels were similar, but the bands were of different size in tumor and normal samples Image collected and cropped by CiteAb from the following publication (//molecular-cancer.biomedcentral.com/articles/10.1186/s12943-016-0495-5), licensed under a CC-BY license.")
![Immunocytochemistry/Immunofluorescence: NKCC2/SLC12A1 Antibody [NBP1-80993] - Staining of human cell line RPTEC TERT1 shows localization to nucleus & vesicles. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/NKCC2-SLC12A1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-80993-img0007.jpg "Immunocytochemistry/Immunofluorescence: NKCC2/SLC12A1 Antibody [NBP1-80993] - Staining of human cell line RPTEC TERT1 shows localization to nucleus & vesicles. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: NKCC2/SLC12A1 Antibody [NBP1-80993] - Staining of human cerebellum shows no positivity in Purkinje cells as expected.](http://images.novusbio.com/fullsize/NKCC2-SLC12A1-Antibody-Immunohistochemistry-Paraffin-NBP1-80993-img0012.jpg "Immunohistochemistry-Paraffin: NKCC2/SLC12A1 Antibody [NBP1-80993] - Staining of human cerebellum shows no positivity in Purkinje cells as expected.")
![Immunohistochemistry-Paraffin: NKCC2/SLC12A1 Antibody [NBP1-80993] - Staining of human kidney shows strong membranous positivity in cells in tubules.](http://images.novusbio.com/fullsize/NKCC2-SLC12A1-Antibody-Immunohistochemistry-Paraffin-NBP1-80993-img0014.jpg "Immunohistochemistry-Paraffin: NKCC2/SLC12A1 Antibody [NBP1-80993] - Staining of human kidney shows strong membranous positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: NKCC2/SLC12A1 Antibody [NBP1-80993] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/NKCC2-SLC12A1-Antibody-Immunohistochemistry-Paraffin-NBP1-80993-img0015.jpg "Immunohistochemistry-Paraffin: NKCC2/SLC12A1 Antibody [NBP1-80993] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: NKCC2/SLC12A1 Antibody [NBP1-80993] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/NKCC2-SLC12A1-Antibody-Immunohistochemistry-Paraffin-NBP1-80993-img0016.jpg "Immunohistochemistry-Paraffin: NKCC2/SLC12A1 Antibody [NBP1-80993] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.")
![Western Blot RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Western_Blot_10216.jpg)
![Immunocytochemistry RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Immunocytochemistry_10464.jpg)
![Simple Western RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Simple_Western_16629.jpg)
![Western Blot Uromodulin Antibody [Unconjugated]](https://images.novusbio.com/images2/Uromodulin_AF5175_Western_Blot_5648.jpg)
![Immunohistochemistry Uromodulin Antibody [Unconjugated]](https://images.novusbio.com/images2/Uromodulin_AF5175_Immunohistochemistry_12099.jpg)
![Immunocytochemistry/ Immunofluorescence Uromodulin Antibody [Unconjugated]](https://images.novusbio.com/images/af5175_mouse-uromodulin-affinity-purified-polyclonal-ab-41202410481117.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")