![Immunohistochemistry-Paraffin: BSND Antibody [NBP2-49101] - Staining in human kidney and liver tissues using NBP2-49101 antibody. Corresponding BSND RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/BSND-Antibody-Immunohistochemistry-Paraffin-NBP2-49101-img0012.jpg "Immunohistochemistry-Paraffin: BSND Antibody [NBP2-49101] - Staining in human kidney and liver tissues using NBP2-49101 antibody. Corresponding BSND RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SPQQEPQGCRCPLDRFQDFALIDAPTLEDEPQEGQQWEIALPNNWQRYPRTKVEEKEASDTGGEEPEKEEEDLYYGLPDGAGDL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | BSND |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2), 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP2-49101 | Applications | Species |
|---|---|---|
| van der Valk WH, van Beelen ESA, Steinhart MR et al. A single-cell level comparison of human inner ear organoids with the human cochlea and vestibular organs Cell reports 2023-06-06 [PMID: 37289589] |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Edward van Beelen |
IHC-P | Mouse | 06/30/2020 |
Summary
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | BSND |
![Immunohistochemistry-Paraffin: BSND Antibody [NBP2-49101] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/BSND-Antibody-Immunohistochemistry-Paraffin-NBP2-49101-img0001.jpg "Immunohistochemistry-Paraffin: BSND Antibody [NBP2-49101] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: BSND Antibody [NBP2-49101] - Staining of human salivary gland shows moderate to strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/BSND-Antibody-Immunohistochemistry-Paraffin-NBP2-49101-img0002.jpg "Immunohistochemistry-Paraffin: BSND Antibody [NBP2-49101] - Staining of human salivary gland shows moderate to strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: BSND Antibody [NBP2-49101] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/BSND-Antibody-Immunohistochemistry-Paraffin-NBP2-49101-img0003.jpg "Immunohistochemistry-Paraffin: BSND Antibody [NBP2-49101] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: BSND Antibody [NBP2-49101] - Barttin is expressed by dark cells surrounding the ampulla and utricle in the adult mouse vestibular system. Antibody at 1:1000. Nuclei stained with DAPI. IHC-P image submitted by a verified customer review.](http://images.novusbio.com/fullsize/BSND-Antibody-Immunohistochemistry-Paraffin-NBP2-49101-img0009.jpg "Immunohistochemistry-Paraffin: BSND Antibody [NBP2-49101] - Barttin is expressed by dark cells surrounding the ampulla and utricle in the adult mouse vestibular system. Antibody at 1:1000. Nuclei stained with DAPI. IHC-P image submitted by a verified customer review.")
![Immunohistochemistry-Paraffin: BSND Antibody [NBP2-49101] - Staining of human kidney, liver, salivary gland and skeletal muscle using Anti-BSND antibody NBP2-49101 (A) shows similar protein distribution across tissues to independent antibody NBP2-62634 (B).](http://images.novusbio.com/fullsize/BSND-Antibody-Immunohistochemistry-Paraffin-NBP2-49101-img0010.jpg "Immunohistochemistry-Paraffin: BSND Antibody [NBP2-49101] - Staining of human kidney, liver, salivary gland and skeletal muscle using Anti-BSND antibody NBP2-49101 (A) shows similar protein distribution across tissues to independent antibody NBP2-62634 (B).")
![Immunohistochemistry-Paraffin: BSND Antibody [NBP2-49101] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/BSND-Antibody-Immunohistochemistry-Paraffin-NBP2-49101-img0011.jpg "Immunohistochemistry-Paraffin: BSND Antibody [NBP2-49101] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Western Blot Galectin-10 Antibody [Unconjugated]](https://images.novusbio.com/images2/Galectin-10_AF5447_Western_Blot_5721.jpg)
![Intracellular Staining by Flow Cytometry Galectin-10 Antibody [Unconjugated]](https://images.novusbio.com/images2/Galectin-10_AF5447_Flow_Cytometry_8273.jpg)
![Intracellular Staining by Flow Cytometry Galectin-10 Antibody [Unconjugated]](https://images.novusbio.com/images2/af5447_human-galectin-10-affinity-purified-polyclonal-ab-flow-cytometry-2162021133613.jpg)
![Immunohistochemistry CLC Antibody (138815) [Unconjugated]](https://images.novusbio.com/images2/CLC_MAB962_Immunohistochemistry_17289.jpg)
![Western Blot Uromodulin Antibody [Unconjugated]](https://images.novusbio.com/images2/Uromodulin_AF5175_Western_Blot_5648.jpg)
![Immunohistochemistry Uromodulin Antibody [Unconjugated]](https://images.novusbio.com/images2/Uromodulin_AF5175_Immunohistochemistry_12099.jpg)
![Immunocytochemistry/ Immunofluorescence Uromodulin Antibody [Unconjugated]](https://images.novusbio.com/images/af5175_mouse-uromodulin-affinity-purified-polyclonal-ab-41202410481117.jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_6973.jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_9671.jpg)
![Immunoprecipitation CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images/mab25031_human-cftr-c-terminus-mab-clone-24-1-41202412513815.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
