Home » UHRF1 » UHRF1 Proteins » UHRF1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

UHRF1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for UHRF1 Recombinant Protein Antigen (NBP2-68720PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

UHRF1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human UHRF1.

Source: E. coli

Amino Acid Sequence: RARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
UHRF1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-68720.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for UHRF1 Recombinant Protein Antigen

  • E3 ubiquitin-protein ligase UHRF1
  • EC 6.3.2
  • EC 6.3.2.-
  • FLJ21925
  • hNp95
  • hUHRF1
  • HuNp95
  • ICBP90
  • ICBP90NP95
  • Inverted CCAAT box-binding protein of 90 kDa
  • NP95
  • Nuclear protein 95
  • Nuclear zinc finger protein Np95
  • RING finger protein 106
  • RNF106
  • RNF106MGC138707
  • Transcription factor ICBP90
  • Ubiquitin-like PHD and RING finger domain-containing protein 1
  • ubiquitin-like with PHD and ring finger domains 1
  • ubiquitin-like, containing PHD and RING finger domains, 1
  • Ubiquitin-like-containing PHD and RING finger domains protein 1
  • UHRF1

Background

UHRF1 encodes a member of a subfamily of RING-finger type E3 ubiquitin ligases. The protein binds to specific DNA sequences, and recruits a histone deacetylase to regulate gene expression. Its expression peaks at late G1 phase and continues during G2 and M phases of the cell cycle. It plays a major role in the G1/S transition by regulating topoisomerase IIalpha and retinoblastoma gene expression, and functions in the p53-dependent DNA damage checkpoint. Multiple transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

DNMT1 Antibody
(60B1220.1) - BSA Fre
NB100-56519
Flow Cytometry DNMT1 Antibody (60B1220.1) - BSA Free
Flow Cytometry DNMT1 Antibody (60B1220.1) - BSA Free
Immunoprecipitation DNMT1 Antibody (60B1220.1) - BSA Free
(4 Reviews)
(144 Publications)
Species: Bv, Hu, Mu, Po, Rt, Sh
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
HDAC1 Antibody
NB100-56340
Knockout Validated HDAC1 Antibody
Simple Western HDAC1 Antibody
Western Blot HDAC1 Antibody
(2 Reviews)
(19 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
NIRF Antibody -
BSA Free
NBP2-94538
Immunocytochemistry/ Immunofluorescence NIRF Antibody - BSA Free
Immunohistochemistry-Paraffin NIRF Antibody - BSA Free
Western Blot NIRF Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
SR-AI/MSR Antibody
- BSA Free
NBP1-00092
Flow Cytometry SR-AI/MSR Antibody - BSA Free
Immunohistochemistry-Frozen SR-AI/MSR Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence SR-AI/MSR Antibody - BSA Free
(2 Reviews)
(8 Publications)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, PLA, WB
SRA1 Antibody
(1D4H8) - BSA Free
NBP1-51531
Western Blot SRA1 Antibody (1D4H8) - BSA Free
Immunohistochemistry-Paraffin SRA1 Antibody (1D4H8) - BSA Free
(1 Publication)
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
APBB3 Antibody
(OTI5G3)
NBP2-01367
Flow Cytometry APBB3 Antibody (OTI5G3)
Western Blot APBB3 Antibody (OTI5G3)
Immunohistochemistry-Paraffin APBB3 Antibody (OTI5G3)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Histone H3
Antibody - BSA Free
NB500-171
Immunohistochemistry-Paraffin Histone H3 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Histone H3 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Histone H3 Antibody - BSA Free
(8 Reviews)
(34 Publications)
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
p19ARF/CDKN2A
Antibody - BSA Free
NB200-106
Immunohistochemistry p19ARF/CDKN2A Antibody - BSA Free
Western Blot p19ARF/CDKN2A Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence p19ARF/CDKN2A Antibody - BSA Free
(1 Review)
(48 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
E2F-1 Antibody
(JJ092-02)
NBP2-67899
Flow Cytometry E2F-1 Antibody (JJ092-02)
Immunocytochemistry/ Immunofluorescence E2F-1 Antibody (JJ092-02)
Immunocytochemistry/ Immunofluorescence E2F-1 Antibody (JJ092-02)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
PCNA Antibody
(PC10)
NB500-106
Immunocytochemistry/ Immunofluorescence PCNA Antibody (PC10)
Western Blot PCNA Antibody (PC10)
Flow Cytometry PCNA Antibody (PC10)
(5 Reviews)
(45 Publications)
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
RB1 Antibody
(607121) [Unconjugate
MAB6495
Western Blot RB1 Antibody (607121) [Unconjugated]
Immunocytochemistry RB1 Antibody (607121) [Unconjugated]
Simple Western RB1 Antibody (607121) [Unconjugated]
(5 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin p21/CIP1/CDKN1A Antibody (WA-1)
(24 Publications)
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
PHRF1 Antibody
NBP1-18933
Western Blot PHRF1 Antibody
Species: Hu, Mu
Applications: IP, WB
VEGF [HRP]
DVE00
N/A VEGF [HRP]
N/A VEGF [HRP]
N/A VEGF [HRP]
(682 Publications)
Species: Hu
Applications: ELISA
IL-17B Antibody
[Unconjugated]
AF1709
Intracellular Staining by Flow Cytometry IL-17B Antibody [Unconjugated]
(2 Publications)
Species: Mu
Applications: Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICFlow, WB
G9a/EHMT2 Antibody
(A8620A) [Unconjugate ...
PP-A8620A-00
Western Blot G9a/EHMT2 Antibody (A8620A) [Unconjugated]
Immunohistochemistry G9a/EHMT2 Antibody (A8620A) [Unconjugated]
Immunohistochemistry G9a/EHMT2 Antibody (A8620A) [Unconjugated]
(17 Publications)
Species: Hu, Mu
Applications: DirELISA, IHC, IP, WB
ALDH9A1 Antibody
NBP1-89150
Western Blot ALDH9A1 Antibody
Western Blot ALDH9A1 Antibody
Immunohistochemistry-Paraffin ALDH9A1 Antibody
(3 Publications)
Species: Hu, Rt
Applications: IHC, IHC-P, WB
ARHGAP24 Antibody
NBP1-84161
Immunohistochemistry-Paraffin ARHGAP24 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
UHRF1 Recombinant
Protein Antigen
NBP2-68720PEP
UHRF1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for UHRF1 Recombinant Protein Antigen (NBP2-68720PEP) (0)

There are no publications for UHRF1 Recombinant Protein Antigen (NBP2-68720PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UHRF1 Recombinant Protein Antigen (NBP2-68720PEP) (0)

There are no reviews for UHRF1 Recombinant Protein Antigen (NBP2-68720PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for UHRF1 Recombinant Protein Antigen (NBP2-68720PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional UHRF1 Products

Research Areas for UHRF1 Recombinant Protein Antigen (NBP2-68720PEP)

Find related products by research area.

Blogs on UHRF1.

Check out the latest blog posts on UHRF1.
Chromatin reader domains of DNMT-targeting protein, UHRF1, are responsible for cancerous DNA hypermethylation
By Jamshed Arslan, Pharm. D., PhD. DNA methylation represses transcription of many genes, including tumor suppressor genes. A protein called UHRF1 recruits DNA methyltransferases (DNMTs) to establish and maintain DNA...  Read full blog post.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Flow Cytometry: DNMT1 Antibody (60B1220.1) [NB100-56519] - Analysis of PE conjugate of NB100-56519. An intracellular stain was performed on HeLa cells with DNMT1 antibody (60B1220.1) NB100-56519PE (blue) and a matched isotype control NBP2-27287PE (orange). Cells were fixed with 4% PFA and then permeablized with 0
DNMT1 Antibody (60B1220.1) - BSA Free
NB100-56519

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our UHRF1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol UHRF1