![Western Blot: U2AF2 Antibody [NBP2-33397] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.](http://images.novusbio.com/fullsize/U2AF2-Antibody-Western-Blot-NBP2-33397-img0008.jpg "Western Blot: U2AF2 Antibody [NBP2-33397] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, Simple Western, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNATLVS |
| Predicted Species | Mouse (100%), Rat (98%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | U2AF2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP2-33397 | Applications | Species |
|---|---|---|
| Zhao L, Zang Q, Liang G, Yao X LncRNA CECR7 boosts hepatocellular carcinoma progression by recruiting RNA binding protein U2AF2 to enhance the stability of EXO1 mRNA Heliyon 2023-09-01 [PMID: 37809785] (RIP, Human) | RIP | Human |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry: U2AF2 Antibody [NBP2-33397] - Staining of human colon shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/U2AF2-Antibody-Immunohistochemistry-NBP2-33397-img0001.jpg "Immunohistochemistry: U2AF2 Antibody [NBP2-33397] - Staining of human colon shows strong nuclear positivity in glandular cells.")
![Simple Western: U2AF2 Antibody [NBP2-33397] - Simple Western lane view shows a specific band for U2AF2 in 0.2 mg/ml of HEK 293T lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://images.novusbio.com/fullsize/U2AF2-Antibody-Simple-Western-NBP2-33397-img0005.jpg "Simple Western: U2AF2 Antibody [NBP2-33397] - Simple Western lane view shows a specific band for U2AF2 in 0.2 mg/ml of HEK 293T lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system.")
![Simple Western: U2AF2 Antibody [NBP2-33397] - Electropherogram image of the corresponding Simple Western lane view. U2AF2 antibody was used at 1:25 dilution on HEK 293T lysate(s) respectively.](http://images.novusbio.com/fullsize/U2AF2-Antibody-Simple-Western-NBP2-33397-img0006.jpg "Simple Western: U2AF2 Antibody [NBP2-33397] - Electropherogram image of the corresponding Simple Western lane view. U2AF2 antibody was used at 1:25 dilution on HEK 293T lysate(s) respectively.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")