![Western Blot: TXNL4B Antibody [NBP2-93577] - Analysis of extracts of mouse liver, using TXNL4B .Exposure time: 90s.](http://images.novusbio.com/fullsize/TXNL4B-Antibody-Western-Blot-NBP2-93577-img0001.jpg "Western Blot: TXNL4B Antibody [NBP2-93577] - Analysis of extracts of mouse liver, using TXNL4B .Exposure time: 90s.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-149 of human TXNL4B (NP_060323.1). MSFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVDQTAVYTQYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFIDLIEVIYRGAMRGKLIVQSPIDPKNIPKYDLLYQDI |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TXNL4B |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 17 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Immunohistochemistry Neurophysin II/Arg-vasopressin Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af009_human-neurophysin-ii-affinity-purified-polyclonal-ab-immunohistochemistry-2812202013195.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for TXNL4B Antibody (NBP2-93577)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TXNL4B |
![Immunocytochemistry/Immunofluorescence: TXNL4B Antibody [NBP2-93577] - Immunofluorescence analysis of A-549 cells using TXNL4B antibody (NBP2-93577).](http://images.novusbio.com/fullsize/TXNL4B-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-93577-img0002.jpg "Immunocytochemistry/Immunofluorescence: TXNL4B Antibody [NBP2-93577] - Immunofluorescence analysis of A-549 cells using TXNL4B antibody (NBP2-93577).")
![Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free](https://images.novusbio.com/images/Androgen-R-NR3C4-p-Ser213-p-Ser210-Antibody-156C135-2-Western-Blot-NB100-56603-img0004.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![Western Blot Syndecan-2/CD362 Antibody [Unconjugated]](https://images.novusbio.com/images2/Syndecan-2_AF6585_Western_Blot_11618.jpg)
![Immunohistochemistry Syndecan-2/CD362 Antibody [Unconjugated]](https://images.novusbio.com/images2/Syndecan-2_AF6585_Immunohistochemistry_11640.jpg)
![Flow Cytometry Syndecan-2/CD362 Antibody [Unconjugated]](https://images.novusbio.com/images2/Syndecan-2_AF6585_Flow_Cytometry_11674.jpg)
![Immunohistochemistry Endorepellin/Perlecan/Heparan Sulfate Proteoglycan Antibody [Unconjugated]](https://images.novusbio.com/images2/Endorepellin_AF2364_Immunohistochemistry_6744.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")