Home » THAP1 » THAP1 Proteins » THAP1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

THAP1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for THAP1 Recombinant Protein Antigen (NBP2-56308PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

THAP1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human THAP1.

Source: E. coli

Amino Acid Sequence: VNLSVFCDHNYTVEDTMHQRKRIHQLEQQVEKLRKKLKTAQQRCRRQERQLEKLKEVVHFQKEKDDVSERGYVILPNDYF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
THAP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56308.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for THAP1 Recombinant Protein Antigen

  • 4833431A01Rik
  • dystonia 6, torsion (autosomal dominant)
  • DYT6
  • FLJ10477
  • MGC33014
  • nuclear proapoptotic factor
  • THAP domain containing, apoptosis associated protein 1
  • THAP domain protein 1
  • THAP domain-containing protein 1

Background

THAP1 is encoded by this gene contains a THAP domain, a conserved DNA-binding domain. This protein colocalizes with the apoptosis response protein PAWR/PAR-4 in promyelocytic leukemia (PML) nuclear bodies, and functions as a proapoptotic factor that links PAWR to PML nuclear bodies. Alternatively spliced transcript variants encoding distinct isoforms have been observed.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Torsin A Antibody
- BSA Free
NBP3-03780
Immunohistochemistry-Paraffin Torsin A Antibody - BSA Free
Immunohistochemistry-Paraffin Torsin A Antibody - BSA Free
Western Blot Torsin A Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Glut1 Antibody -
BSA Free
NB110-39113
Western Blot Glut1 Antibody - BSA Free
Flow Cytometry Glut1 Antibody - BSA Free
Western Blot Glut1 Antibody - BSA Free
(7 Reviews)
(62 Publications)
Species: Hu, Mu, Rb, Rt
Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, Simple Western, WB
Sodium Potassium
ATPase Alpha 3 Antibo ...
NB300-540
Immunocytochemistry/ Immunofluorescence Sodium Potassium ATPase Alpha 3 Antibody (XVIF9-G10) - BSA Free
Immunocytochemistry/ Immunofluorescence Sodium Potassium ATPase Alpha 3 Antibody (XVIF9-G10) - BSA Free
Immunocytochemistry/ Immunofluorescence Sodium Potassium ATPase Alpha 3 Antibody (XVIF9-G10) - BSA Free
(2 Reviews)
(21 Publications)
Species: Bv, Ca, Gp, Hu, Mu, Pm, Rb, Rt, Sh
Applications: B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, Single-Cell Western, WB
GCH1 Antibody
NBP1-84949
Immunohistochemistry-Paraffin GCH1 Antibody
Immunohistochemistry-Paraffin GCH1 Antibody
Immunohistochemistry-Paraffin GCH1 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
PKR Antibody
(HL71/10) [Unconjugat
MAB1980
Simple Western PKR Antibody (HL71/10) [Unconjugated]
Immunocytochemistry PKR Antibody (HL71/10) [Unconjugated]
Western Blot PKR Antibody (HL71/10) [Unconjugated]
(9 Publications)
Species: Hu
Applications: ICC, IP, Simple Western, WB

epsilon-Sarcoglycan An
NBP1-59794
Immunohistochemistry epsilon-Sarcoglycan Antibody
Western Blot epsilon-Sarcoglycan Antibody
Western Blot epsilon-Sarcoglycan Antibody
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Tyrosine
Hydroxylase Antibody
NB300-109
Immunohistochemistry-Frozen Tyrosine Hydroxylase Antibody
Immunohistochemistry Tyrosine Hydroxylase Antibody
Immunohistochemistry Tyrosine Hydroxylase Antibody
(7 Reviews)
(232 Publications)
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
KAT4/TBP
Associated Factor 1 A
NBP1-77847
Immunohistochemistry KAT4/TBP Associated Factor 1 Antibody
Immunohistochemistry KAT4/TBP Associated Factor 1 Antibody
Western Blot KAT4/TBP Associated Factor 1 Antibody
Species: Hu, Mu
Applications: ChIP, ELISA, IHC, IHC-P, IP, WB
LRP2 Antibody
(CD7D5) - Azide and B ...
NB110-96417
Immunocytochemistry/ Immunofluorescence LRP2 Antibody (CD7D5) - Azide and BSA Free
Immunohistochemistry LRP2 Antibody (CD7D5) - Azide and BSA Free
Immunohistochemistry-Paraffin LRP2 Antibody (CD7D5) - Azide and BSA Free
(1 Review)
(21 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
MCF2L Antibody
(1D11)
H00023263-M01
Sandwich ELISA MCF2L Antibody (1D11)
Immunohistochemistry-Paraffin MCF2L Antibody (1D11)
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
PNKD Antibody
NBP1-88347
Western Blot PNKD Antibody
Immunocytochemistry/ Immunofluorescence PNKD Antibody
Immunohistochemistry-Paraffin PNKD Antibody
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
PML Protein
Antibody - BSA Free
NB100-59787
Western Blot PML Protein Antibody - BSA Free
Immunohistochemistry PML Protein Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence PML Protein Antibody - BSA Free
(1 Review)
(42 Publications)
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, PLA, WB

CAMP/LL37/FALL39/Cathe ...
NBP1-76864
Immunohistochemistry-Paraffin CAMP/LL37/FALL39/Cathelicidin Antibody - BSA Free
Western Blot CAMP/LL37/FALL39/Cathelicidin Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence CAMP/LL37/FALL39/Cathelicidin Antibody - BSA Free
(3 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
RRM1 Antibody
(HL1231) - Azide and ...
NBP3-25643
Western Blot RRM1 Antibody (HL1231) - Azide and BSA Free
Western Blot RRM1 Antibody (HL1231) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence RRM1 Antibody (HL1231) - Azide and BSA Free
Species: Ca, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Host Cell Factor
1/HCFC1 Antibody
NB100-68209
Knockdown Validated Host Cell Factor 1/HCFC1 Antibody
Immunoprecipitation Host Cell Factor 1/HCFC1 Antibody
Western Blot Host Cell Factor 1/HCFC1 Antibody
(5 Publications)
Species: Hu
Applications: IP, KD, WB
RB1 Antibody
(607121) [Unconjugate
MAB6495
Western Blot RB1 Antibody (607121) [Unconjugated]
Immunocytochemistry RB1 Antibody (607121) [Unconjugated]
Simple Western RB1 Antibody (607121) [Unconjugated]
(5 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
E2F6 Antibody
NBP2-14936
Immunocytochemistry/ Immunofluorescence E2F6 Antibody
Immunohistochemistry-Paraffin E2F6 Antibody
Western Blot E2F6 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
CIZ1 Antibody
NB100-74624
Western Blot CIZ1 Antibody
(10 Publications)
Species: Hu, Mu
Applications: ICC/IF, IP, WB

Publications for THAP1 Recombinant Protein Antigen (NBP2-56308PEP) (0)

There are no publications for THAP1 Recombinant Protein Antigen (NBP2-56308PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for THAP1 Recombinant Protein Antigen (NBP2-56308PEP) (0)

There are no reviews for THAP1 Recombinant Protein Antigen (NBP2-56308PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for THAP1 Recombinant Protein Antigen (NBP2-56308PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional THAP1 Products

Research Areas for THAP1 Recombinant Protein Antigen (NBP2-56308PEP)

Find related products by research area.

Blogs on THAP1

There are no specific blogs for THAP1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

10x Magnification cryo-sections mouse: primary antibody: anti-rb TH: 1:500; o.n. secondary antibody: 1:500 dk-anti-rb DyLight488. IHC-Fr image submitted by a verified customer review.
Tyrosine Hydroxylase Antibody
NB300-109
Western Blot: Glut1 Antibody [NB110-39113] - Glut1 in human brain lysate (55 kDa). Antibody at 1:500. Western blot image submitted by a verified customer review.
Glut1 Antibody - BSA Free
NB110-39113

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our THAP1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol THAP1