Novus Biologicals products are now on bio-techne.com

TdT Recombinant Protein Antigen

Name: TdT Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP3-21261PEP
Price: 279 USD

Images

There are currently no images for TdT Recombinant Protein Antigen (NBP3-21261PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

TdT Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TdT Source: E.coli Amino Acid Sequence: DEEQLLQKVMNLWEKKGLLLYYDLVESTFEKLRLPSRKVDALDHFQKCFLIFKLPRQRVDSDQSSWQEGKTWKAIRVDLVLCPYE Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	DNTT
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10-100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21261. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	28 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TdT Recombinant Protein Antigen

deoxynucleotidyltransferase, terminal
DNTT
EC 2.7.7
EC 2.7.7.31
nucleosidetriphosphate:DNA deoxynucleotidylexotransferase
TdT
TDTDNA nucleotidylexotransferase
Terminal addition enzyme
Terminal deoxynucleotidyltransferase
terminal deoxyribonucleotidyltransferase
Terminal transferase

Background

TdT is a nuclear enzyme involved in the recombination of Immunoglobulin and T cell receptor genes. TdT is expressed in early lymphoid cells and by tumor cells in certain classes of acute lymphoid leukemia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Neprilysin/CD10
Antibody [Unconjugate

AF1126

Western Blot Neprilysin/CD10 Antibody [Unconjugated]

(22 Publications)

Species: Mu

Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB

Caspase-3 Antibody
[Unconjugated] - Acti ...

AF835

Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active

(7 Reviews)

(388 Publications)

Species: Hu, Mu

Applications: ICC, IHC

HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...

NBP2-79843

Immunocytochemistry/ Immunofluorescence HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free

Western Blot HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free

Species: Hu

Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB

CTLA-4
[Unconjugated]

7268-CT

(3 Publications)

Species: Hu

Applications: BA

NOD2 Antibody
(2D9) - BSA Free

NB100-524

Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free

(1 Review)

(26 Publications)

Species: Hu, Mu

Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

CD34 Antibody
[Unconjugated]

AF4117

(3 Reviews)

(37 Publications)

Species: Rt

Applications: IHC, WB

Bcl-2 Antibody

NB100-56098

(2 Reviews)

(26 Publications)

Species: Ca, Hu, Mu, Rt

Applications: IHC, IHC-P, IP, WB

CD3 Antibody (SP7)

NB600-1441

Immunohistochemistry-Paraffin CD3 Antibody (SP7)

(3 Reviews)

(44 Publications)

Species: Ca, Hu, Mu, Po

Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KD

CD19 Antibody
(CB19) - BSA Free

NBP2-25196

(1 Review)

(12 Publications)

Species: Hu, Mu

Applications: CyTOF-ready, Flow, ICC/IF, In vitro, WB

Myeloperoxidase/MPO An ...

AF3667

Simple Western Myeloperoxidase/MPO Antibody [Unconjugated]

Immunocytochemistry Myeloperoxidase/MPO Antibody [Unconjugated]

(3 Reviews)

(167 Publications)

Species: Hu, Mu

Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB

CD20 Antibody
(AISB12) - BSA Free

NBP1-43435

Flow Cytometry CD20 Antibody (AISB12) - BSA Free

(3 Publications)

Species: Hu, Mu

Applications: Flow, WB

CD7 Antibody
(5B10E3) - BSA Free

NBP2-37368

Western Blot CD7 Antibody (5B10E3) - BSA Free

(1 Review)

Species: Hu

Applications: CyTOF-ready, ELISA, Flow, IMC, IHC, IHC-P, WB

CD45 Antibody
[Unconjugated]

AF114

Immunocytochemistry CD45 Antibody [Unconjugated]

Immunocytochemistry/ Immunofluorescence CD45 Antibody [Unconjugated]

(1 Review)

(70 Publications)

Species: Mu

Applications: CyTOF-ready, Flow, ICC, IHC, WB

Cytokeratin 20
Antibody (SA35-03)

NBP2-67309

Immunocytochemistry/ Immunofluorescence Cytokeratin 20 Antibody (SA35-03)

Immunohistochemistry-Paraffin Cytokeratin 20 Antibody (SA35-03)

Species: Hu, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB

p53 Antibody (PAb
240) - BSA Free

NB200-103

Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free

(3 Reviews)

(42 Publications)

Species: Hu, Mu, Rt, Xp(-), Ye

Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

Adenosine
Deaminase/ADA Antibod

NBP1-87404

Immunocytochemistry/ Immunofluorescence Adenosine Deaminase/ADA Antibody

(4 Publications)

Species: Hu, Mu, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB

PCNA Antibody
(PC10)

NB500-106

(5 Reviews)

(45 Publications)

Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze

Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB

TNF-alpha
[Unconjugated]

210-TA

(3 Reviews)

(811 Publications)

Species: Hu

Applications: BA

CD4 Antibody - BSA
Free

NBP1-19371

Immunohistochemistry-Paraffin CD4 Antibody - BSA Free

(9 Reviews)

(50 Publications)

Species: Ca, Hu, Mu, Po, Rb, Rt

Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB

TdT Recombinant
Protein Antigen

NBP3-21261PEP

Species: Hu

Applications: AC

Publications for TdT Recombinant Protein Antigen (NBP3-21261PEP) (0)

There are no publications for TdT Recombinant Protein Antigen (NBP3-21261PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TdT Recombinant Protein Antigen (NBP3-21261PEP) (0)

There are no reviews for TdT Recombinant Protein Antigen (NBP3-21261PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TdT Recombinant Protein Antigen (NBP3-21261PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TdT Products

Research Areas for TdT Recombinant Protein Antigen (NBP3-21261PEP)

Find related products by research area.

Blogs on TdT.

Check out the latest blog posts on TdT.

TdT (Terminal Deoxynucleotidyl Transferase)
The enzyme family of DNA polymerases plays a fundamental role in the replication, repair, and recombination of nucleic acid. Its members include DNA Polymerase b (Pol b), DNA Polymerase g (Pol g), and DNA Polymerase m (Pol m). TdT is a very unique and... Read full blog post.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.

TNF-alpha [Unconjugated]
210-TA-005

Caspase‑3 was detected in immersion fixed anti-FAS treated Jurkat human acute T cell leukemia cell line using 0.3 µg/mL Human/Mouse Active Caspase‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF835) for 3 hours at room temperature. Cells were stained (red) and counterstained (green). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.

Caspase-3 Antibody [Unconjugated] - Active
AF835

Western blot shows lysates of HL-60 human acute promyelocytic leukemia cell line, human neutrophil cells, and mouse spleen tissue. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse Myeloperoxidase/MPO Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3667) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (HAF019). A specific band was detected for Myeloperoxidase/MPO at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 2.

Myeloperoxidase/MPO Antibody [Unconjugated]
AF3667

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our TdT Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

DNTT

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

TdT Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

TdT Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for TdT Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for TdT Recombinant Protein Antigen (NBP3-21261PEP) (0)

Reviews for TdT Recombinant Protein Antigen (NBP3-21261PEP) (0)

FAQs for TdT Recombinant Protein Antigen (NBP3-21261PEP) (0)

Additional TdT Products

Research Areas for TdT Recombinant Protein Antigen (NBP3-21261PEP)

Blogs on TdT.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics