I am looking for an antibody of STEAP2 and find that there are 3 different STEAP2 antisera on the product list. But the information of antigen is not very clear for these products. Because STEAP2 has several isoforms, I wonder if you can clarify which isoform can be detected by each antibody. I will appreciate it if you can tell me the peptide sequence of each antigen.

Name: STEAP2 Antibody [DyLight 594]
Brand: Novus Biologicals
SKU: NBP1-76823DL594
Price: 499 USD

Question

Accepted Answer

We have four STEAP2 antibodies and typically if the immunogen is not provided on the datasheet than it is deemed proprietary by the lab and cannot be provided. For catalog number NBP1-83100 however the immunogen is EYLASLFPDSLIVKGFNVVSAWALQLGPKD ASRQVYICSNNIQARQQVIELARQLNFIPI DLGSLSSAREIE For the other products I would have to get in touch with the lab to see if it could detect isoform 1 or 2. I can also inquire if they can provide a range it targets in if that would be useful. Typically though if it is indicated as C-terminal it will be within the last 50 amino acids. Was there a particular species or isoform you were interested in?

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Reactivity	Hu, MuSpecies Glossary
Applications	WB, ELISA, ICC/IF, IHC
Clonality	Polyclonal
Host	Rabbit
Conjugate	DyLight 594

Catalog# & Conjugate	Size	Price
Alexa Fluor 350 NBP1-76823AF350

Alexa Fluor 405 NBP1-76823AF405

Alexa Fluor 488 NBP1-76823AF488

Alexa Fluor 532 NBP1-76823AF532

Alexa Fluor 594 NBP1-76823AF594

Alexa Fluor 647 NBP1-76823AF647

Alexa Fluor 700 NBP1-76823AF700

Alexa Fluor 750 NBP1-76823AF750

Biotin NBP1-76823B

CoraFluor 1 NBP1-76823CL1

DyLight 350 NBP1-76823UV

DyLight 405 NBP1-76823V

DyLight 488 NBP1-76823G

DyLight 550 NBP1-76823R

DyLight 650 NBP1-76823C

DyLight 680 NBP1-76823FR

DyLight 755 NBP1-76823IR

FITC NBP1-76823F

HRP NBP1-76823H

Janelia Fluor 525 NBP1-76823JF525

Janelia Fluor 549 NBP1-76823JF549

Janelia Fluor 646 NBP1-76823JF646

Janelia Fluor 669 NBP1-76823JF669

PerCP NBP1-76823PCP

Unconjugated NBP1-76823

mFluor Violet 450 SE NBP1-76823MFV450

mFluor Violet 500 SE NBP1-76823MFV500

mFluor Violet 610 SE NBP1-76823MFV610

Catalog# & Formulation	Size	Price
Standard Formulation NBP1-76823

BSA Free NBP1-76823

BSA Free NBP1-76823-0.025mg

Conjugate	Catalog #	Availability	Size	Price
Alexa Fluor 350	NBP1-76823AF350
Alexa Fluor 405	NBP1-76823AF405
Alexa Fluor 488	NBP1-76823AF488
Alexa Fluor 532	NBP1-76823AF532
Alexa Fluor 594	NBP1-76823AF594
Alexa Fluor 647	NBP1-76823AF647
Alexa Fluor 700	NBP1-76823AF700
Alexa Fluor 750	NBP1-76823AF750
Biotin	NBP1-76823B
CoraFluor 1	NBP1-76823CL1
DyLight 350	NBP1-76823UV
DyLight 405	NBP1-76823V
DyLight 488	NBP1-76823G
DyLight 550	NBP1-76823R
DyLight 650	NBP1-76823C
DyLight 680	NBP1-76823FR
DyLight 755	NBP1-76823IR
FITC	NBP1-76823F
HRP	NBP1-76823H
Janelia Fluor 525	NBP1-76823JF525
Janelia Fluor 549	NBP1-76823JF549
Janelia Fluor 646	NBP1-76823JF646
Janelia Fluor 669	NBP1-76823JF669
PerCP	NBP1-76823PCP
Unconjugated	NBP1-76823
mFluor Violet 450 SE	NBP1-76823MFV450
mFluor Violet 500 SE	NBP1-76823MFV500
mFluor Violet 610 SE	NBP1-76823MFV610

STEAP2 Antibody [DyLight 594]

Species Glossary

Images

Product Details

Order Details

STEAP2 Antibody [DyLight 594] Summary

Applications/Dilutions

Reactivity Notes

Packaging, Storage & Formulations

Notes

Alternate Names for STEAP2 Antibody [DyLight 594]

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for STEAP2 Antibody (NBP1-76823DL594) (0)

Reviews for STEAP2 Antibody (NBP1-76823DL594) (0)

Product General Protocols

Video Protocols

FAQs for STEAP2 Antibody (NBP1-76823DL594). (Showing 1 - 1 of 1 FAQ).

Secondary Antibodies

Isotype Controls

Additional STEAP2 Products

Blogs on STEAP2

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics

Immunogen	Antibody was raised against a 16 amino acid synthetic peptide from near the carboxy terminus of human STEAP2. The immunogen is located within the last 50 amino acids of STEAP2. Amino Acid Squence: KLKRIKKGWEKSQFLE
Specificity	This STEAP2 antibody does not cross-react with other STEAP proteins.
Isotype	IgG
Clonality	Polyclonal
Host	Rabbit
Gene	STEAP2
Purity	Peptide affinity purified
Innovator's Reward	Test in a species/application not listed above to receive a full credit towards a future purchase. Learn about the Innovator's Reward

Dilutions	ELISA Immunocytochemistry/ Immunofluorescence Immunohistochemistry Immunohistochemistry-Paraffin Western Blot
Application Notes	Optimal dilution of this antibody should be experimentally determined.

Storage	Store at 4C in the dark.
Buffer	50mM Sodium Borate
Preservative	0.05% Sodium Azide
Purity	Peptide affinity purified