Novus Biologicals products are now on bio-techne.com

SMURF2 Recombinant Protein Antigen

Images

 
There are currently no images for SMURF2 Recombinant Protein Antigen (NBP2-57554PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

SMURF2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SMURF2.

Source: E. coli

Amino Acid Sequence: LSCFVDENTPISGTNGATCGQSSDPRLAERRVRSQRHRNYMSRTHLHTPPD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SMURF2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57554.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SMURF2 Recombinant Protein Antigen

  • DKFZp686F0270
  • E3 ubiquitin ligase SMURF2
  • E3 ubiquitin-protein ligase SMURF2
  • EC 6.3.2
  • EC 6.3.2.-
  • hSMURF2
  • MGC138150
  • SMAD specific E3 ubiquitin protein ligase 2
  • SMAD ubiquitination regulatory factor 2
  • SMAD-specific E3 ubiquitin-protein ligase 2
  • SMURF2

Background

Smad ubiquitination regulatory factor proteins (Smurf1 and Smurf2) are E3 ubiquitin ligase that belongs to the Hect family. Smurf proteins play an important role as regulators in TGF-beta pathway by ubiquitinating Smads and Smads associated proteins for proteasome degradation (1). Specifically, Smurf1 interacts with Smad1 and Smad5 for degradation, while Smurf2 ubiquitinates Smad1 and Smad2. Smads also functions to recruit Smurfs to various pathway components such as TGF-beta and SnoN. In particular, Smad7 acts as an adaptor protein between Smurfs and TGF-Beta receptors, allowing the receptors to be marked by Smurfs for degradation (2). Smurf2 interacts with all members of Smad family except for Smad4 and it is expressed various tissues and cell lines, such as placenta and ovarian cancer cell lines. Smurf2 has been implicated in the tumor formation and diseases progression (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB2029
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
AF3797
Species: Hu, Mu
Applications: ChIP, ICC, IHC, Simple Western, WB
H00057154-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP1-89150
Species: Hu, Rt
Applications: IHC, IHC-P, WB
H00011026-M01
Species: Hu
Applications: ELISA, WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
NB100-56479
Species: Bv, Ca, Hu, Mu, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF3025
Species: Hu
Applications: ELISA, ICC, WB
NBP2-21037
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-31361
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP1-77306
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
7754-BH/CF
Species: Hu
Applications: BA
AF2097
Species: Hu
Applications: ChIP, ICC, WB
NBP3-35329
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
AF2039
Species: Hu
Applications: IHC, Simple Western, WB
H00054778-M05
Species: Hu
Applications: ELISA, ICC/IF, KD, WB
NBP1-77305
Species: Hu
Applications: ELISA, ICC/IF, WB

Publications for SMURF2 Recombinant Protein Antigen (NBP2-57554PEP) (0)

There are no publications for SMURF2 Recombinant Protein Antigen (NBP2-57554PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SMURF2 Recombinant Protein Antigen (NBP2-57554PEP) (0)

There are no reviews for SMURF2 Recombinant Protein Antigen (NBP2-57554PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SMURF2 Recombinant Protein Antigen (NBP2-57554PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SMURF2 Products

Research Areas for SMURF2 Recombinant Protein Antigen (NBP2-57554PEP)

Find related products by research area.

Blogs on SMURF2

There are no specific blogs for SMURF2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SMURF2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SMURF2