![Immunohistochemistry-Paraffin: SLC26A4 Antibody [NBP1-85237] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.](http://images.novusbio.com/fullsize/SLC26A4-Antibody-Immunohistochemistry-Paraffin-NBP1-85237-img0009.jpg "Immunohistochemistry-Paraffin: SLC26A4 Antibody [NBP1-85237] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FGLLTVVLRVQFPSWNGLGSIPSTDIYKSTKNYKNIEEPQGVKILRFSSPIFYGNVDGFKKCIKSTVGFDAIRVYNKRLKALRK |
| Predicted Species | Rat (90%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLC26A4 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
IF | Human | 03/01/2019 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Research Areas for SLC26A4 Antibody (NBP1-85237)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SLC26A4 |
![Immunohistochemistry-Paraffin: SLC26A4 Antibody [NBP1-85237] - Staining of human thyroid gland shows weak to moderate cytoplasmic and membranous positivity in follicle cells.](http://images.novusbio.com/fullsize/SLC26A4-Antibody-Immunohistochemistry-Paraffin-NBP1-85237-img0004.jpg "Immunohistochemistry-Paraffin: SLC26A4 Antibody [NBP1-85237] - Staining of human thyroid gland shows weak to moderate cytoplasmic and membranous positivity in follicle cells.")
![Immunohistochemistry-Frozen: SLC26A4 Antibody [NBP1-85237] - Human thyroid tissue was incubated with anti-SLC26A4 antibody at dilution 1:100 overnight at 4C and detected with Alexa Fluor 488 Donkey anti-rabbit at dilution 1:1000. Nuclei stained with DAPI. Image from verified customer review.](http://images.novusbio.com/fullsize/SLC26A4-Antibody-Immunohistochemistry-Frozen-NBP1-85237-img0006.jpg "Immunohistochemistry-Frozen: SLC26A4 Antibody [NBP1-85237] - Human thyroid tissue was incubated with anti-SLC26A4 antibody at dilution 1:100 overnight at 4C and detected with Alexa Fluor 488 Donkey anti-rabbit at dilution 1:1000. Nuclei stained with DAPI. Image from verified customer review.")
![Immunohistochemistry-Paraffin: SLC26A4 Antibody [NBP1-85237] - Staining of human cervix shows no positivity in squamous epithelial cells as expected.](http://images.novusbio.com/fullsize/SLC26A4-Antibody-Immunohistochemistry-Paraffin-NBP1-85237-img0007.jpg "Immunohistochemistry-Paraffin: SLC26A4 Antibody [NBP1-85237] - Staining of human cervix shows no positivity in squamous epithelial cells as expected.")
![Immunohistochemistry-Paraffin: SLC26A4 Antibody [NBP1-85237] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/SLC26A4-Antibody-Immunohistochemistry-Paraffin-NBP1-85237-img0008.jpg "Immunohistochemistry-Paraffin: SLC26A4 Antibody [NBP1-85237] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunocytochemistry RUNX2/CBFA1 Antibody (232902) [Unconjugated]](https://images.novusbio.com/images2/RUNX2_MAB2006_Immunocytochemistry_13309.jpg)
![Bioactivity Thrombopoietin/THPO [Unconjugated]](https://images.novusbio.com/images/protein/288-tpncf_recombinant-human-thrombopoietin-ns0-expressed-protein-cf-bioactivity-272020135047.jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_6973.jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_9671.jpg)
![Immunoprecipitation CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images/mab25031_human-cftr-c-terminus-mab-clone-24-1-41202412513815.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
