![Immunohistochemistry-Paraffin: WIRE Antibody [NBP1-86856] - Analysis in human cerebral cortex and liver tissues using NBP1-86856 antibody. Corresponding WIRE RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/WIRE-Antibody-Immunohistochemistry-Paraffin-NBP1-86856-img0018.jpg "Immunohistochemistry-Paraffin: WIRE Antibody [NBP1-86856] - Analysis in human cerebral cortex and liver tissues using NBP1-86856 antibody. Corresponding WIRE RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PPPYRMHGSEPPSRGKPPPPPSRTPAGPPPPPPPPLRNGHRDSITTVRSFLDDFESKYSFHPVEDFPAPEEYKHFQ |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | WIPF2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | WIPF2 |
![Immunohistochemistry-Paraffin: WIRE Antibody [NBP1-86856] - Staining of human cerebral cortex, colon, fallopian tube and liver using Anti-WIRE antibody NBP1-86856 (A) shows similar protein distribution across tissues to independent antibody NBP1-86858 (B).](http://images.novusbio.com/fullsize/WIRE-Antibody-Immunohistochemistry-Paraffin-NBP1-86856-img0017.jpg "Immunohistochemistry-Paraffin: WIRE Antibody [NBP1-86856] - Staining of human cerebral cortex, colon, fallopian tube and liver using Anti-WIRE antibody NBP1-86856 (A) shows similar protein distribution across tissues to independent antibody NBP1-86858 (B).")
![Western Blot: WIRE Antibody [NBP1-86856] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/WIRE-Antibody-Western-Blot-NBP1-86856-img0019.jpg "Western Blot: WIRE Antibody [NBP1-86856] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunohistochemistry-Paraffin: WIRE Antibody [NBP1-86856] - Staining of human liver shows very weak positivyt in hepatocytes as expected.](http://images.novusbio.com/fullsize/WIRE-Antibody-Immunohistochemistry-Paraffin-NBP1-86856-img0023.jpg "Immunohistochemistry-Paraffin: WIRE Antibody [NBP1-86856] - Staining of human liver shows very weak positivyt in hepatocytes as expected.")
![Western Blot: WIRE Antibody [NBP1-86856] - Analysis using Anti-WIPF2 antibody NBP1-86856 (A) shows similar pattern to independent antibody NBP1-86858 (B).](http://images.novusbio.com/fullsize/WIRE-Antibody-Western-Blot-NBP1-86856-img0016.jpg "Western Blot: WIRE Antibody [NBP1-86856] - Analysis using Anti-WIPF2 antibody NBP1-86856 (A) shows similar pattern to independent antibody NBP1-86858 (B).")
![Immunohistochemistry-Paraffin: WIRE Antibody [NBP1-86856] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/WIRE-Antibody-Immunohistochemistry-Paraffin-NBP1-86856-img0020.jpg "Immunohistochemistry-Paraffin: WIRE Antibody [NBP1-86856] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.")
![Immunohistochemistry-Paraffin: WIRE Antibody [NBP1-86856] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/WIRE-Antibody-Immunohistochemistry-Paraffin-NBP1-86856-img0021.jpg "Immunohistochemistry-Paraffin: WIRE Antibody [NBP1-86856] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: WIRE Antibody [NBP1-86856] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/WIRE-Antibody-Immunohistochemistry-Paraffin-NBP1-86856-img0022.jpg "Immunohistochemistry-Paraffin: WIRE Antibody [NBP1-86856] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.")
![Intracellular Staining by Flow Cytometry Serpin A5/Protein C Inhibitor Antibody (210326) [Unconjugated]](https://images.novusbio.com/images/antibody/mab1266_human-serpin-a5-mab-clone-210326-intracellular-staining-by-flow-cytometry-662020192248.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![Complement Component C2 Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Complement Component C2 Antibody [Unconjugated]")
![N/A Endothelin-1 [HRP]](https://images.novusbio.com/images2/Endothelin-1_QET00_ELISA_432.jpg)
![N/A Endothelin-1 [HRP]](https://images.novusbio.com/images2/DATA_Endothelin1_QET00_ELISA_1074.jpg)
![Immunocytochemistry Nucleostemin Antibody [Unconjugated]](https://images.novusbio.com/images2/Nucleostemin_AF1638_Immunocytochemistry_6472.jpg)
![Simple Western Nucleostemin Antibody [Unconjugated]](https://images.novusbio.com/images2/Nucleostemin_AF1638_Simple_Western_18959.jpg)
![Western Blot Nucleostemin Antibody [Unconjugated]](https://images.novusbio.com/images2/Nucleostemin_AF1638_Western_Blot_18960.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")