![Immunohistochemistry-Paraffin: SLC26A2 Antibody [NBP2-49271] - Analysis in human colon and liver tissues using NBP2-49271antibody. Corresponding SLC26A2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/SLC26A2-Antibody-Immunohistochemistry-Paraffin-NBP2-49271-img0007.jpg "Immunohistochemistry-Paraffin: SLC26A2 Antibody [NBP2-49271] - Analysis in human colon and liver tissues using NBP2-49271antibody. Corresponding SLC26A2 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ESKEQHNVSPRDSAEGNDSYPSGIHLELQRESSTDFKQFETNDQCRPYHRILIERQEKSDTNFKEFVIKKLQKNCQCSP |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLC26A2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for SLC26A2 Antibody (NBP2-49271)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SLC26A2 |
![Western Blot: SLC26A2 Antibody [NBP2-49271] - Analysis in control (vector only transfected HEK293T lysate) and SLC26A2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/SLC26A2-Antibody-Western-Blot-NBP2-49271-img0005.jpg "Western Blot: SLC26A2 Antibody [NBP2-49271] - Analysis in control (vector only transfected HEK293T lysate) and SLC26A2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
![Immunohistochemistry-Paraffin: SLC26A2 Antibody [NBP2-49271] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/SLC26A2-Antibody-Immunohistochemistry-Paraffin-NBP2-49271-img0011.jpg "Immunohistochemistry-Paraffin: SLC26A2 Antibody [NBP2-49271] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: SLC26A2 Antibody [NBP2-49271] - Staining of human colon shows strong membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/SLC26A2-Antibody-Immunohistochemistry-Paraffin-NBP2-49271-img0008.jpg "Immunohistochemistry-Paraffin: SLC26A2 Antibody [NBP2-49271] - Staining of human colon shows strong membranous positivity in glandular cells.")
![Immunohistochemistry-Paraffin: SLC26A2 Antibody [NBP2-49271] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/SLC26A2-Antibody-Immunohistochemistry-Paraffin-NBP2-49271-img0009.jpg "Immunohistochemistry-Paraffin: SLC26A2 Antibody [NBP2-49271] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: SLC26A2 Antibody [NBP2-49271] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/SLC26A2-Antibody-Immunohistochemistry-Paraffin-NBP2-49271-img0010.jpg "Immunohistochemistry-Paraffin: SLC26A2 Antibody [NBP2-49271] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.")
![N/A COMP/Thrombospondin-5 [HRP]](https://images.novusbio.com/images2/COMP_DCMP0_ELISA_66.jpg)
![N/A COMP/Thrombospondin-5 [HRP]](https://images.novusbio.com/images2/DATA_COMP_DCMP0_ELISA_632.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")