![Immunohistochemistry-Paraffin: SLC22A12 Antibody [NBP1-82500] - Analysis in human kidney and testis tissues using NBP1-82500 antibody. Corresponding SLC22A12 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/SLC22A12-Antibody-Immunohistochemistry-Paraffin-NBP1-82500-img0008.jpg "Immunohistochemistry-Paraffin: SLC22A12 Antibody [NBP1-82500] - Analysis in human kidney and testis tissues using NBP1-82500 antibody. Corresponding SLC22A12 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ESARWLLTTGRLDWGLQELWRVAAINGKGAVQDTLTPEVLLSAMREELSMGQPPASLGTLLRMPGLRFRTCI |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLC22A12 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SLC22A12 |
![Immunohistochemistry-Paraffin: SLC22A12 Antibody [NBP1-82500] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.](http://images.novusbio.com/fullsize/SLC22A12-Antibody-Immunohistochemistry-Paraffin-NBP1-82500-img0010.jpg "Immunohistochemistry-Paraffin: SLC22A12 Antibody [NBP1-82500] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.")
![Immunohistochemistry-Paraffin: SLC22A12 Antibody [NBP1-82500] - Staining of human kidney shows high expression.](http://images.novusbio.com/fullsize/SLC22A12-Antibody-Immunohistochemistry-Paraffin-NBP1-82500-img0005.jpg "Immunohistochemistry-Paraffin: SLC22A12 Antibody [NBP1-82500] - Staining of human kidney shows high expression.")
![Immunohistochemistry-Paraffin: SLC22A12 Antibody [NBP1-82500] - Staining of human lymph node shows no positivity in lymphoid cells as expected.](http://images.novusbio.com/fullsize/SLC22A12-Antibody-Immunohistochemistry-Paraffin-NBP1-82500-img0009.jpg "Immunohistochemistry-Paraffin: SLC22A12 Antibody [NBP1-82500] - Staining of human lymph node shows no positivity in lymphoid cells as expected.")
![Immunohistochemistry-Paraffin: SLC22A12 Antibody [NBP1-82500] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/SLC22A12-Antibody-Immunohistochemistry-Paraffin-NBP1-82500-img0011.jpg "Immunohistochemistry-Paraffin: SLC22A12 Antibody [NBP1-82500] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Western Blot Uromodulin Antibody [Unconjugated]](https://images.novusbio.com/images2/Uromodulin_AF5175_Western_Blot_5648.jpg)
![Immunohistochemistry Uromodulin Antibody [Unconjugated]](https://images.novusbio.com/images2/Uromodulin_AF5175_Immunohistochemistry_12099.jpg)
![Immunocytochemistry/ Immunofluorescence Uromodulin Antibody [Unconjugated]](https://images.novusbio.com/images/af5175_mouse-uromodulin-affinity-purified-polyclonal-ab-41202410481117.jpg)
![N/A Follistatin [HRP]](https://images.novusbio.com/images2/Follistatin_DFN00_ELISA_97.jpg)
![N/A Follistatin [HRP]](https://images.novusbio.com/images2/DATA_Follistatin_DFN00_ELISA_681.jpg)
![N/A Follistatin [HRP]](https://images.novusbio.com/images2/DATA_Follistatin_DFN00_ELISA_682.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")