![Immunohistochemistry-Paraffin: SLC22A8 Antibody [NBP1-92396] - Analysis in human kidney and tonsil tissues using NBP1-92396 antibody. Corresponding SLC22A8 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/SLC22A8-Antibody-Immunohistochemistry-Paraffin-NBP1-92396-img0002.jpg "Immunohistochemistry-Paraffin: SLC22A8 Antibody [NBP1-92396] - Analysis in human kidney and tonsil tissues using NBP1-92396 antibody. Corresponding SLC22A8 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KKEEGERLSLEELKLNLQKEISLAKAKYTASDLFRIPMLR |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLC22A8 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-92396 | Applications | Species |
|---|---|---|
| Susa K, Kobayashi K, Galichon P et al. ATP/ADP biosensor organoids for drug nephrotoxicity assessment Frontiers in cell and developmental biology 2023-03-02 [PMID: 36936695] (ICC/IF, Human) | ICC/IF | Human |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SLC22A8 |
![Immunohistochemistry-Paraffin: SLC22A8 Antibody [NBP1-92396] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.](http://images.novusbio.com/fullsize/SLC22A8-Antibody-Immunohistochemistry-Paraffin-NBP1-92396-img0006.jpg "Immunohistochemistry-Paraffin: SLC22A8 Antibody [NBP1-92396] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.")
![Immunohistochemistry-Paraffin: SLC22A8 Antibody [NBP1-92396] - Staining of human kidney shows moderate positivity in baslolateral membrane cells in tubules.](http://images.novusbio.com/fullsize/SLC22A8-Antibody-Immunohistochemistry-Paraffin-NBP1-92396-img0003.jpg "Immunohistochemistry-Paraffin: SLC22A8 Antibody [NBP1-92396] - Staining of human kidney shows moderate positivity in baslolateral membrane cells in tubules.")
![Immunohistochemistry-Paraffin: SLC22A8 Antibody [NBP1-92396] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/SLC22A8-Antibody-Immunohistochemistry-Paraffin-NBP1-92396-img0004.jpg "Immunohistochemistry-Paraffin: SLC22A8 Antibody [NBP1-92396] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: SLC22A8 Antibody [NBP1-92396] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/SLC22A8-Antibody-Immunohistochemistry-Paraffin-NBP1-92396-img0005.jpg "Immunohistochemistry-Paraffin: SLC22A8 Antibody [NBP1-92396] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Immunohistochemistry SLC22A2/OCT2 Antibody (640438) [Unconjugated]](https://images.novusbio.com/images2/SLC22A2_MAB6547_Immunohistochemistry_10365.jpg)
![Flow Cytometry SLC22A2/OCT2 Antibody (640438) [Unconjugated]](https://images.novusbio.com/images2/mab6547_human-slc22a2-oct2-mab-clone-640438-flow-cytometry-169202115433.jpg)
![Multiplex Immunofluorescence SLC22A2/OCT2 Antibody (640438) [Unconjugated]](https://images.novusbio.com/images/antibody/mab6547_human-slc22a2-oct2-mab-clone-640438-multiplex-immunofluorescence-15112024124421..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")