Novus Biologicals products are now on bio-techne.com

Sirtuin 3/SIRT3 Recombinant Protein Antigen

Name: Sirtuin 3/SIRT3 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-87037PEP
Price: 279 USD

Submit a Review

Images

There are currently no images for Sirtuin 3/SIRT3 Protein (NBP1-87037PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Sirtuin 3/SIRT3 Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SIRT3. Source: E. coli Amino Acid Sequence: FSVGASSVVGSGGSSDKGKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYT Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	SIRT3
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87037. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	31 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Sirtuin 3/SIRT3 Recombinant Protein Antigen

EC 3.5.1
EC 3.5.1.-
hSIRT3
mitochondrial nicotinamide adenine dinucleotide-dependent deacetylase
NAD-dependent deacetylase sirtuin-3, mitochondrial
SIR2L3
SIR2L3silent mating type information regulation 2, S.cerevisiae, homolog 3
sir2-like 3
SIR2-like protein 3
SIRT3
sirtuin (silent mating type information regulation 2 homolog) 3 (S. cerevisiae)
sirtuin (silent mating type information regulation 2, S.cerevisiae, homolog) 3
Sirtuin 3
sirtuin type 3

Background

SIRT3 is expected to recognize both reported isoforms (NP_036371.1 and NP_001017524.1).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Sirtuin 1/SIRT1
Antibody (1F3) - BSA ...

NBP1-51641

Flow Cytometry Sirtuin 1/SIRT1 Antibody (1F3) - BSA Free

Immunocytochemistry/ Immunofluorescence Sirtuin 1/SIRT1 Antibody (1F3) - BSA Free

(9 Publications)

Species: Hu, Mu, Pm, Rb, Rt

Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, WB

Sir2.1 Antibody

NB100-1923

(1 Review)

(2 Publications)

Species: Ce

Applications: IHC, IHC-P, IP, WB

SIRT4 Antibody

NB100-1406

Immunohistochemistry-Paraffin SIRT4 Antibody

(5 Publications)

Species: Hu

Applications: IHC, IHC-P, PEP-ELISA, WB

Sirtuin 5/SIRT5
Antibody (OTI2F1) - A ...

NBP2-74199

Species: Hu, Mu, Rt

Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, KO, WB

Insulin Antibody
(182410) [Unconjugate ...

MAB1417

Immunohistochemistry Insulin Antibody (182410) [Unconjugated]

(24 Publications)

Species: Bv, Hu, Mu

Applications: CyTOF-ready, ICC, IHC, ICFlow

PBEF/Visfatin/NAMPT An

NB100-594

Immunohistochemistry-Paraffin PBEF/Visfatin/NAMPT Antibody

(10 Publications)

Species: Hu, Mu

Applications: IHC, IHC-P, IP, WB

p53 Antibody (PAb
240) - BSA Free

NB200-103

Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free

(3 Reviews)

(42 Publications)

Species: Hu, Mu, Rt, Xp(-), Ye

Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

AMPK alpha 2
Antibody [Unconjugate

AF2850

Simple Western AMPK alpha 2 Antibody [Unconjugated]

Immunocytochemistry AMPK alpha 2 Antibody [Unconjugated]

(11 Publications)

Species: Hu, Mu, Rt

Applications: ICC, IHC, Simple Western, WB

AMPK alpha 1
Antibody (2B7) - BSA

NBP2-22127

ELISA AMPK alpha 1 Antibody (2B7) - BSA Free

(12 Publications)

Species: Hu, Mu, Pm, Rt

Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB

AMPK beta 1
Antibody [Unconjugate

AF2854

Immunohistochemistry AMPK beta 1 Antibody [Unconjugated]

(2 Publications)

Species: Hu, Mu, Rt

Applications: IHC, WB

SIRT6 Antibody

NB100-2524

Immunocytochemistry/ Immunofluorescence SIRT6 Antibody

(1 Publication)

Species: Hu

Applications: ICC/IF, WB

SOD2/Mn-SOD
Antibody

NB100-1992

Immunocytochemistry/ Immunofluorescence SOD2/Mn-SOD Antibody

(42 Publications)

Species: Bv, Ca, Ch, Dr, Gt, Gp, Ha, Hu, Pm, Mu, Po, Rb, Rt, Sh, Sq, Xp

Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB

FOXO3 Antibody

NBP2-16521

Immunocytochemistry/ Immunofluorescence FOXO3 Antibody

(4 Reviews)

(12 Publications)

Species: Hu, Mu, Rt, Sq, Xp

Applications: ChIP, ICC/IF, IHC, IHC-P, IP, KD, WB

Acetyl CoA
synthetase Antibody

NBP1-90276

(2 Publications)

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P, WB

Bcl-2 Antibody

NB100-56098

(2 Reviews)

(26 Publications)

Species: Ca, Hu, Mu, Rt

Applications: IHC, IHC-P, IP, WB

Catalase Antibody
[Unconjugated]

AF3398

Simple Western Catalase Antibody [Unconjugated]

Knockout Validated Catalase Antibody [Unconjugated]

(3 Reviews)

(15 Publications)

Species: Hu, Mu, Rt

Applications: ICC, KO, Simple Western, WB

Cyclophilin 40
Antibody (PSH02-71)

NBP3-32238

Immunohistochemistry Cyclophilin 40 Antibody (PSH02-71)

Immunocytochemistry/ Immunofluorescence Cyclophilin 40 Antibody (PSH02-71)

Species: Hu, Pm

Applications: Flow, ICC/IF, IHC, IHC-P, WB

PGC1 alpha
Antibody - BSA Free

NBP1-04676

Immunohistochemistry-Paraffin PGC1 alpha Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence PGC1 alpha Antibody - BSA Free

(11 Reviews)

(278 Publications)

Species: Gt, Ha, Hu, Mu, Po, Rt, Sh, Sq

Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, WB

Mitofusin 2
Antibody (4H8)

H00009927-M03

Immunohistochemistry-Paraffin Mitofusin 2 Antibody (4H8)

(1 Review)

(40 Publications)

Species: Hu, Rt

Applications: ELISA, IHC, IHC-P, RNAi, WB

PPAR gamma/NR1C3
Antibody - BSA Free

NBP2-22106

Immunohistochemistry-Paraffin PPAR gamma/NR1C3 Antibody - BSA Free

(2 Reviews)

(11 Publications)

Species: Hu, Mu, Rt

Applications: IHC, IHC-P, IP, WB

Publications for Sirtuin 3/SIRT3 Protein (NBP1-87037PEP) (0)

There are no publications for Sirtuin 3/SIRT3 Protein (NBP1-87037PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Sirtuin 3/SIRT3 Protein (NBP1-87037PEP) (0)

There are no reviews for Sirtuin 3/SIRT3 Protein (NBP1-87037PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Sirtuin 3/SIRT3 Protein (NBP1-87037PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Sirtuin 3/SIRT3 Products

Research Areas for Sirtuin 3/SIRT3 Protein (NBP1-87037PEP)

Find related products by research area.

Epigenetics

Blogs on Sirtuin 3/SIRT3

There are no specific blogs for Sirtuin 3/SIRT3, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Vehicle or RU 486 (5 mg/kg) injected mice were presented with/without corticosterone (10 mg/kg) for 3 days. The expressions of peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PGC1 alpha NBP1-04676) and NIX (BNIP3L NBP1-88558) were visualized via western blotting. Loading control is beta-actin. n = 5. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/33473105/) licensed under a CC-BY license.

PGC1 alpha Antibody - BSA Free
NBP1-04676

Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.

p53 Antibody (PAb 240) - BSA Free
NB200-103

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our Sirtuin 3/SIRT3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

SIRT3

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Sirtuin 3/SIRT3 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

Sirtuin 3/SIRT3 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for Sirtuin 3/SIRT3 Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for Sirtuin 3/SIRT3 Protein (NBP1-87037PEP) (0)

Reviews for Sirtuin 3/SIRT3 Protein (NBP1-87037PEP) (0)

FAQs for Sirtuin 3/SIRT3 Protein (NBP1-87037PEP) (0)

Additional Sirtuin 3/SIRT3 Products

Research Areas for Sirtuin 3/SIRT3 Protein (NBP1-87037PEP)

Blogs on Sirtuin 3/SIRT3

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics