![Western Blot: SIRT4 Antibody [NBP1-80002] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:62500 Positive Control: MCF7 cell lysate](http://images.novusbio.com/fullsize/SIRT4-Antibody-Western-Blot-NBP1-80002-img0010.jpg "Western Blot: SIRT4 Antibody [NBP1-80002] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:62500 Positive Control: MCF7 cell lysate")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | Synthetic peptide directed towards the middle region of human SIRT4. Peptide sequence QVPTCVQCGGHLKPDVVFFGDTVNPDKVDFVHKRVKEADSLLVVGSSLQV. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SIRT4 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 53 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for SIRT4 Antibody (NBP1-80002)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry: SIRT4 Antibody [NBP1-80002] - Staining of a pancreas crossection.](http://images.novusbio.com/fullsize/SIRT4-Antibody-Immunohistochemistry-NBP1-80002-img0008.jpg "Immunohistochemistry: SIRT4 Antibody [NBP1-80002] - Staining of a pancreas crossection.")
![Western Blot: SIRT4 Antibody [NBP1-80002] - Antibody Titration: 1 ug/ml Human Liver.](http://images.novusbio.com/fullsize/SIRT4-Antibody-Western-Blot-NBP1-80002-img0005.jpg "Western Blot: SIRT4 Antibody [NBP1-80002] - Antibody Titration: 1 ug/ml Human Liver.")
![Western Blot: SIRT4 Antibody [NBP1-80002] - MCF7 Lane A: Primary Antibody Lane B: Primary Antibody + Blocking Peptide Primary Antibody Concentration: 1 ug/ml Peptide Concentration: 5 ug/ml lysate Quantity: 25ug/ Lane/ Lane Gel Concentration: 0.12.](http://images.novusbio.com/fullsize/SIRT4-Antibody-Western-Blot-NBP1-80002-img0007.jpg "Western Blot: SIRT4 Antibody [NBP1-80002] - MCF7 Lane A: Primary Antibody Lane B: Primary Antibody + Blocking Peptide Primary Antibody Concentration: 1 ug/ml Peptide Concentration: 5 ug/ml lysate Quantity: 25ug/ Lane/ Lane Gel Concentration: 0.12.")
![Western Blot: SIRT4 Antibody [NBP1-80002] - Antibody Titration: 1 ug/ml Human Raji.](http://images.novusbio.com/fullsize/SIRT4-Antibody-Western-Blot-NBP1-80002-img0006.jpg "Western Blot: SIRT4 Antibody [NBP1-80002] - Antibody Titration: 1 ug/ml Human Raji.")
![Western Blot: SIRT4 Antibody [NBP1-80002] - Sample Tissue: Human Fetal Liver Antibody Dilution: 1.0 ug/ml](http://images.novusbio.com/fullsize/SIRT4-Antibody-Western-Blot-NBP1-80002-img0009.jpg "Western Blot: SIRT4 Antibody [NBP1-80002] - Sample Tissue: Human Fetal Liver Antibody Dilution: 1.0 ug/ml")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")