Home » SHIP2/INPPL1 » SHIP2/INPPL1 Proteins » Recombinant Human SHIP2/INPPL1 GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human SHIP2/INPPL1 GST (N-Term) Protein

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, MA, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human SHIP2/INPPL1 GST (N-Term) Protein Summary

Description
Recombinant protein with a N-terminal GST tagcorresponding to the amino acids 1159-1258 of Human INPPL1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: PSDYGRPLSFPPPRIRESIQEDLAEEAPCLQGGRASGLGEAGMSAWLRAIGLERYEEGLVHNGWDDLEFLSDITEEDLEEAGVQDPAHKRLLLDTLQLSK
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
INPPL1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Immunohistochemistry
  • Protein Array
  • Western Blot
Publications
Read Publication using H00003636-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SHIP2/INPPL1 GST (N-Term) Protein

  • EC 3.1.3
  • EC 3.1.3.n1
  • inositol polyphosphate phosphatase-like 1
  • Inositol polyphosphate phosphatase-like protein 1
  • INPPL1
  • INPPL-1
  • phosphatidylinositol-34,5-trisphosphate 5-phosphatase 2
  • Protein 51C
  • SH2 domain-containing inositol phosphatase 2
  • SH2 domain-containing inositol-5'-phosphatase 2
  • SHIP2
  • SHIP-2
  • SHIP251C protein

Background

INPPL1 - inositol polyphosphate phosphatase-like 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

SHIP Antibody
(257812) [Unconjugate
MAB2317
Western Blot SHIP Antibody (257812) [Unconjugated]
Immunocytochemistry SHIP Antibody (257812) [Unconjugated]
Knockout Validated SHIP Antibody (257812) [Unconjugated]
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(49 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western Blot Src [p Tyr419] Antibody [Unconjugated]
Simple Western Src [p Tyr419] Antibody [Unconjugated]
Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]
(1 Review)
(10 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
SHC1 Antibody
(OTI3A1)
NBP2-02434
Western Blot SHC1 Antibody (OTI3A1)
Immunohistochemistry-Paraffin SHC1 Antibody (OTI3A1)
Immunohistochemistry-Paraffin SHC1 Antibody (OTI3A1)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Exosome component
10 Antibody
NBP1-32870
Western Blot Exosome component 10 Antibody
Immunohistochemistry-Paraffin Exosome component 10 Antibody
Western Blot Exosome component 10 Antibody
(2 Reviews)
(3 Publications)
Species: Hu
Applications: IHC, IHC-P, IP, KD, WB
PTEN Antibody
[Unconjugated]
AF847
Western Blot PTEN Antibody [Unconjugated]
Simple Western PTEN Antibody [Unconjugated]
Knockout Validated PTEN Antibody [Unconjugated]
(16 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, KO, Simple Western, WB
SHP-1 Antibody
(SR41-02)
NBP2-67321
Western Blot SHP-1 Antibody (SR41-02)
Flow Cytometry SHP-1 Antibody (SR41-02)
Immunocytochemistry/ Immunofluorescence SHP-1 Antibody (SR41-02)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
SLC10A3 Antibody
NBP1-84957
Western Blot SLC10A3 Antibody
Immunohistochemistry-Paraffin SLC10A3 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
Recombinant Human
ATP5G3 GST (N-Term) P ...
H00000518-P01
SDS-PAGE Recombinant Human ATP5G3 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, WB
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Western Blot HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
PI 3-Kinase p110
delta Antibody (OTI1D ...
NBP2-46404
Immunohistochemistry PI 3-Kinase p110 delta Antibody (OTI1D11)
Immunohistochemistry PI 3-Kinase p110 delta Antibody (OTI1D11)
Immunohistochemistry PI 3-Kinase p110 delta Antibody (OTI1D11)
(1 Review)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
PYK2/FAK2 [p
Tyr402] Antibody (592 ...
MAB6210
Simple Western PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]
Western Blot PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]
(1 Review)
(1 Publication)
Species: Hu
Applications: Simple Western, WB
PIK3CA Antibody
NBP2-19804
Western Blot PIK3CA Antibody
Immunohistochemistry-Paraffin PIK3CA Antibody
Western Blot PIK3CA Antibody
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
PI 3-Kinase p110
beta/PIK3CB Antibody ...
MAB2686
Western Blot PI 3-Kinase p110 beta/PIK3CB Antibody (269020)
(5 Publications)
Species: Hu
Applications: WB
PI 3-Kinase p110
gamma Antibody
NBP2-15071
Western Blot PI 3-Kinase p110 gamma Antibody
Western Blot PI 3-Kinase p110 gamma Antibody
Immunohistochemistry-Paraffin PI 3-Kinase p110 gamma Antibody
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
BCR Antibody
AF5129
Western Blot BCR Antibody
(1 Publication)
Species: Hu
Applications: WB
Recombinant Human
SHIP2/INPPL1 GST (N-T ...
H00003636-Q01
Recombinant Human SHIP2/INPPL1 GST (N-Term) Protein
Species: Hu
Applications: WB, ELISA, IHC, MA, AP

Publications for SHIP2/INPPL1 Partial Recombinant Protein (H00003636-Q01)(1)


Reviews for SHIP2/INPPL1 Partial Recombinant Protein (H00003636-Q01) (0)

There are no reviews for SHIP2/INPPL1 Partial Recombinant Protein (H00003636-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SHIP2/INPPL1 Partial Recombinant Protein (H00003636-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SHIP2/INPPL1 Products

Research Areas for SHIP2/INPPL1 Partial Recombinant Protein (H00003636-Q01)

Find related products by research area.

Blogs on SHIP2/INPPL1

There are no specific blogs for SHIP2/INPPL1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western Blot: SHIP2/INPPL1 Antibody (3E6) [H00003636-M01] - INPPL1 monoclonal antibody (M01), clone 3E6 Analysis of INPPL1 expression in HeLa.
SHIP2/INPPL1 Antibody (3E6)
H00003636-M01
Flow Cytometry: NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on Jurkat cells with NOD2 (2D9) antibody NB100-524APC (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes.
NOD2 Antibody (2D9) - BSA Free
NB100-524

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SHIP2/INPPL1 GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol INPPL1