![Western Blot: Serine Dehydratase Antibody [H00010993-B01P] - Analysis of SDS expression in human liver.](http://images.novusbio.com/fullsize/Serine-Dehydratase-Antibody-Western-Blot-H00010993-B01P-img0003.jpg "Western Blot: Serine Dehydratase Antibody [H00010993-B01P] - Analysis of SDS expression in human liver.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | SDS (NP_006834.2, 1 a.a. - 328 a.a.) full-length human protein. MMSGEPLHVKTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQGCAHFVCSSAGNAGMAAAYAARQLGVPATIVVPSTTPALTIERLKNEGATVKVVGELLDEAFELAKALAKNNPGWVYIPPFDDPLIWEGHASIVKELKETLWEKPGAIALSVGGGGLLCGVVQGLQEVGWGDVPVIAMETFGAHSFHAATTAGKLVSLPKITSVAKALGVKTVGAQALKLFQEHPIFSEVISDQEAVAAIEKFVDDEKILVEPACGAALAAVYSHVIQKLQLEGNLRTPLPSLVVIVCGGSNISLAQLRALKEQLGMTNRLPK |
| Specificity | SDS - serine dehydratase, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | SDS |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SDS |
| Entrez |
|
| Uniprot |
|
![Western Blot: Serine Dehydratase Antibody [H00010993-B01P] - Analysis of SDS expression in transfected 293T cell line by SDS polyclonal antibody. Lane 1: SDS transfected lysate(36.08 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/Serine-Dehydratase-Antibody-Western-Blot-H00010993-B01P-img0004.jpg "Western Blot: Serine Dehydratase Antibody [H00010993-B01P] - Analysis of SDS expression in transfected 293T cell line by SDS polyclonal antibody. Lane 1: SDS transfected lysate(36.08 KDa). Lane 2: Non-transfected lysate.")
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")