![Immunocytochemistry/Immunofluorescence: SEC14L2 Antibody (2E5) [H00023541-M05] - Analysis of monoclonal antibody to SEC14L2 on HeLa cell. Antibody concentration 10 ug/ml](http://images.novusbio.com/fullsize/SEC14L2-Antibody-2E5-Immunocytochemistry-Immunofluorescence-H00023541-M05-img0001.jpg "Immunocytochemistry/Immunofluorescence: SEC14L2 Antibody (2E5) [H00023541-M05] - Analysis of monoclonal antibody to SEC14L2 on HeLa cell. Antibody concentration 10 ug/ml")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF |
| Clone | 2E5 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | SEC14L2 (NP_036561.1, 101 a.a. ~ 199 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DIIGPLDAKGLLFSASKQDLLRTKMRECELLLQECAHQTTKLGRKVETITIIYDCEGLGLKHLWKPAVEAYGEFLCMFEENYPETLKRLFVVKAPKLFP |
| Specificity | SEC14L2 - SEC14-like 2 (S. cerevisiae) (2E5) |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | SEC14L2 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for SEC14L2 Antibody (H00023541-M05)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Sandwich ELISA: SEC14L2 Antibody (2E5) [H00023541-M05] - Detection limit for recombinant GST tagged SEC14L2 is 0.3 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/SEC14L2-Antibody-2E5-Sandwich-ELISA-H00023541-M05-img0002.jpg "Sandwich ELISA: SEC14L2 Antibody (2E5) [H00023541-M05] - Detection limit for recombinant GST tagged SEC14L2 is 0.3 ng/ml as a capture antibody.")
![Bioactivity IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFNgamma_285IF_2848.jpg)
![SDS-PAGE IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFN-gamma_285-IF_230.jpg)
![SEC-MALS IFN-gamma [Unconjugated]](https://images.novusbio.com/images/285-if_recombinant-human-ifn-gamma-protein-sec-mals-1520239228..jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
