![Immunohistochemistry: Tapasin Antibody [NBP1-86968] - Immunohistochemistry staining. Analysis of HLA-ABC (MHC I), Tapasin, and CD8 staining in normal tissue and high and low intensity staining in tumor tissue Image collected and cropped by CiteAb from the following publication (//www.translational-medicine.com/content/13/1/279) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/Tapasin-Antibody-Immunohistochemistry-NBP1-86968-img0005.jpg "Immunohistochemistry: Tapasin Antibody [NBP1-86968] - Immunohistochemistry staining. Analysis of HLA-ABC (MHC I), Tapasin, and CD8 staining in normal tissue and high and low intensity staining in tumor tissue Image collected and cropped by CiteAb from the following publication (//www.translational-medicine.com/content/13/1/279) licensed under a CC-BY license.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QEGTYLATIHLPYLQGQVTLELAVYKPPKVSLMPATLARAAPGEAPPELLCLVSHFYPSGGLEVEWELRGGPGGRSQKAEGQRWLSALRHHSDGSVSLSGHLQPPPVTTEQHGARYACRIHHPS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TAPBP |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Immunohistochemistry-Paraffin reported in scientific literature (PMID 26310568) |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
| Publication using NBP1-86968 | Applications | Species |
|---|---|---|
| Sokol L, Koelzer VH, Rau TT et al. Loss of tapasin correlates with diminished CD8(+) T-cell immunity and prognosis in colorectal cancer. J Transl Med. 2015-08-28 [PMID: 26310568] (IHC-P, Human) | IHC-P | Human |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: Tapasin Antibody [NBP1-86968] - Staining of human skeletal muscle shows very weak positivity in endoplasmic reticulum in myocytes.](http://images.novusbio.com/fullsize/Tapasin-Antibody-Immunohistochemistry-Paraffin-NBP1-86968-img0001.jpg "Immunohistochemistry-Paraffin: Tapasin Antibody [NBP1-86968] - Staining of human skeletal muscle shows very weak positivity in endoplasmic reticulum in myocytes.")
![Immunohistochemistry-Paraffin: Tapasin Antibody [NBP1-86968] - Staining of human duodenum shows strong positivity in endoplasmic reticulum in glandular cells.](http://images.novusbio.com/fullsize/Tapasin-Antibody-Immunohistochemistry-Paraffin-NBP1-86968-img0002.jpg "Immunohistochemistry-Paraffin: Tapasin Antibody [NBP1-86968] - Staining of human duodenum shows strong positivity in endoplasmic reticulum in glandular cells.")
![Immunohistochemistry-Paraffin: Tapasin Antibody [NBP1-86968] - Staining of human fallopian tube shows strong positivity in endoplasmic reticulum in neutrophils.](http://images.novusbio.com/fullsize/Tapasin-Antibody-Immunohistochemistry-Paraffin-NBP1-86968-img0003.jpg "Immunohistochemistry-Paraffin: Tapasin Antibody [NBP1-86968] - Staining of human fallopian tube shows strong positivity in endoplasmic reticulum in neutrophils.")
![Immunohistochemistry-Paraffin: Tapasin Antibody [NBP1-86968] - Staining of human tonsil shows moderate to strong positivity in endoplasmic reticulum in non - germinal center cells.](http://images.novusbio.com/fullsize/Tapasin-Antibody-Immunohistochemistry-Paraffin-NBP1-86968-img0004.jpg "Immunohistochemistry-Paraffin: Tapasin Antibody [NBP1-86968] - Staining of human tonsil shows moderate to strong positivity in endoplasmic reticulum in non - germinal center cells.")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![SDS-PAGE IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_40.jpg)
![Bioactivity IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_41.jpg)
![Mass Spectrometry IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_42.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")