SAFB Recombinant Protein Antigen

Images

 
There are currently no images for SAFB Protein (NBP1-83265PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SAFB Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SAFB.

Source: E. coli

Amino Acid Sequence: GDGQEDVETSLENLQDIDIMDISVLDEAEIDNGSVADCVEDDDADNLQESLSDSRELVEGEMKELPEQLQEHAIEDKETINNLDTSSSDFTILQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SAFB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83265.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SAFB Recombinant Protein Antigen

  • glutathione S-transferase fusion protein
  • HAP
  • heat-shock protein (HSP27) estrogen response element and TATA box-bindingprotein
  • HETDKFZp779C1727
  • Hsp27 ERE-TATA binding protein
  • HSP27 ERE-TATA-binding protein
  • HSP27 estrogen response element-TATA box-binding protein
  • SAF-B
  • SAF-B1
  • SAFB1SAB-B1
  • scaffold attachment factor B
  • scaffold attachment factor B1

Background

SAFB encodes a DNA-binding protein that has high specificity for scaffold or matrix attachment region DNA elements (S/MAR DNA). This protein is thought to be involved in attaching the base of chromatin loops to the nuclear matrix but there is conflicting evidence as to whether this protein is a component of chromatin or a nuclear matrix protein. Scaffold attachment factors are a specific subset of nuclear matrix proteins (NMP) that specifically bind to S/MAR. This encoded protein is thought to serve as a molecular base to assemble a 'transcriptosome complex' in the vicinity of actively transcribed genes. It is involved in the regulation of the heat shock protein 27 transcription and also can act as an estrogen receptor corepressor. This gene is a candidate gene for breast tumorigenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB110-74569
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-43435
Species: Hu, Mu
Applications: Flow, WB
H00728695-B01P
Species: Hu
Applications: ICC/IF, IP, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP2-47525
Species: Hu
Applications: IHC, IHC-P, WB
H00006690-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-20265
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NBP2-19533
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-04266
Species: Hu
Applications: ELISA, ICC/IF, WB
H00000053-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
NBP1-86658
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00055835-M02
Species: Hu
Applications: ELISA, IP, S-ELISA, WB
7754-BH/CF
Species: Hu
Applications: BA
NBP1-82847
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-19535
Species: Hu, Mu, Rt, Ze
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
NBP1-83265PEP
Species: Hu
Applications: AC

Publications for SAFB Protein (NBP1-83265PEP) (0)

There are no publications for SAFB Protein (NBP1-83265PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SAFB Protein (NBP1-83265PEP) (0)

There are no reviews for SAFB Protein (NBP1-83265PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SAFB Protein (NBP1-83265PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SAFB Products

Array NBP1-83265PEP

Research Areas for SAFB Protein (NBP1-83265PEP)

Find related products by research area.

Blogs on SAFB

There are no specific blogs for SAFB, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SAFB Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SAFB