Orthogonal Strategies: Immunohistochemistry-Paraffin: S100B Antibody [NBP1-87102] - Analysis in human cerebral cortex and liver tissues. Corresponding S100B RNA-seq data are presented for the same tissues.
Western Blot: S100B Antibody [NBP1-87102] - Analysis in mouse cerebral cortex tissue.
Immunocytochemistry/ Immunofluorescence: S100B Antibody [NBP1-87102] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining Is shown in green.
Immunohistochemistry-Paraffin: S100B Antibody [NBP1-87102] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: S100B Antibody [NBP1-87102] - Staining of human cerebellum shows moderate to strong nuclear positivity in cells in purkinje cell layer.
Immunohistochemistry-Paraffin: S100B Antibody [NBP1-87102] - Staining of human cerebral cortex shows moderate to strong nuclear positivity in glial cells.
Immunohistochemistry-Paraffin: S100B Antibody [NBP1-87102] - Staining of human liver shows no positivity in hepatocytes as expected.
This antibody was developed against Recombinant Protein corresponding to amino acids: LEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
Marker
Astrocyte Marker
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
S100B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
S100B is a zinc- and calcium-binding protein belonging to the S100 protein family within the EF-hand (helix E-loop-helix F) subgroup (1,2). S100B plays a role in normal central nervous system development, is associated with various neurological diseases such as Alzheimer's and Parkinson's, and it serves as a marker for brain injury (1,2). The S100B protein has a homodimeric structure comprised of two 91-amino acid polypeptide monomers each with a theoretical molecular weight of 10.5 kDa (1,2). Furthermore, each monomer contains two EF-hand regions, four helixes, and a hinge region (2). S100B is predominately expressed in astrocytes, oligodendrocytes, and Schwann cells, but also other cell types including adipocytes (1,3). S100B interacts with toll-like receptor 4 (TLR4) and receptor for advanced glycation end products (RAGE), initiating downstream signaling cascades and transcription factors including JNK/JUN, NFkappaB, and p38, leading to caspase and proinflammatory cytokine production (2). Overall outcomes include neuronal apoptosis, neuroinflammation, and neurodegeneration (1,2). S100B is the most commonly studied astroglia and blood brain barrier biomarker in traumatic brain injury (TBI) (3,4). The serum levels of S100B in patients with TBI is indicative of patient outcomes, where high levels correlate with injury severity and mortality (4). S100B is often in used in combination with additional biomarkers such as glial fibrillary acidic protein (GFAP) and ubiquitin c-terminal hydrolase L1 (UCH-L1) (3,4).
References
1. Yardan, T., Erenler, A. K., Baydin, A., Aydin, K., & Cokluk, C. (2011). Usefulness of S100B protein in neurological disorders. JPMA. The Journal of the Pakistan Medical Association, 61(3), 276-281.
2. Langeh, U., & Singh, S. (2021). Targeting S100B Protein as a Surrogate Biomarker and its Role in Various Neurological Disorders. Current neuropharmacology, 19(2), 265-277. https://doi.org/10.2174/1570159X18666200729100427
3. Thelin, E. P., Nelson, D. W., & Bellander, B. M. (2017). A review of the clinical utility of serum S100B protein levels in the assessment of traumatic brain injury. Acta neurochirurgica, 159(2), 209-225. https://doi.org/10.1007/s00701-016-3046-3
4. Wang, K. K., Yang, Z., Zhu, T., Shi, Y., Rubenstein, R., Tyndall, J. A., & Manley, G. T. (2018). An update on diagnostic and prognostic biomarkers for traumatic brain injury. Expert review of molecular diagnostics, 18(2), 165-180. https://doi.org/10.1080/14737159.2018.1428089
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Hernandez S, Dominko T. Regeneration competence accompanies increased expression of arginine methyltransferase PRMT8 in human adult fibroblasts. Northeast Bioengineering Conference (NEBEC). 2014-01-01 (WB, ICC/IF, Human)
Details: PRMT8 antibody used for WB and ICC-IF in experiments involving iRC cell which are acquired via a novel non-viral method implicating exogenous addition of human fibroblast growth factor FGF2 and reduced / 2% O2 concentration. WB showed a band at ~45 kDa and it was compared with other cell types also which included hESCs and cells expressing GST-PRMT8 (Figure 2C). ICC-IF involved 2% paraformaldehyde fixation, permeablization with PBS containing 0.1% Triton X-100, blocking with 5% BSA, primary detection via Alexa-Fluor-488 conjugated secondary antibody (Figure 3).
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our S100B Antibody and receive a gift card or discount.