Novus Biologicals products are now on bio-techne.com

S100B Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: S100B Antibody [NBP1-87102] - Analysis in human cerebral cortex and liver tissues. Corresponding S100B RNA-seq data are presented for the same tissues.
Western Blot: S100B Antibody [NBP1-87102] - Analysis in mouse cerebral cortex tissue.
Immunocytochemistry/ Immunofluorescence: S100B Antibody [NBP1-87102] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining Is shown in green.
Immunohistochemistry-Paraffin: S100B Antibody [NBP1-87102] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: S100B Antibody [NBP1-87102] - Staining of human cerebellum shows moderate to strong nuclear positivity in cells in purkinje cell layer.
Immunohistochemistry-Paraffin: S100B Antibody [NBP1-87102] - Staining of human cerebral cortex shows moderate to strong nuclear positivity in glial cells.
Immunohistochemistry-Paraffin: S100B Antibody [NBP1-87102] - Staining of human liver shows no positivity in hepatocytes as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

S100B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
Marker
Astrocyte Marker
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
S100B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
S100B Recombinant Protein Antigen (NBP1-87102PEP)
Publications
Read Publications using
NBP1-87102 in the following applications:

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 26133460). Mouse reactivity reported in scientific literature (25176044).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for S100B Antibody

  • beta (neural)
  • NEF
  • S100 beta
  • S100 calcium binding protein B
  • S100 calcium-binding protein B
  • S100 calcium-binding protein, beta (neural)
  • S-100 calcium-binding protein, beta chain, 10protein S100-B
  • S-100 protein beta chain
  • S-100 protein subunit beta
  • S100
  • S100B
  • S100beta

Background

S100B is a zinc- and calcium-binding protein belonging to the S100 protein family within the EF-hand (helix E-loop-helix F) subgroup (1,2). S100B plays a role in normal central nervous system development, is associated with various neurological diseases such as Alzheimer's and Parkinson's, and it serves as a marker for brain injury (1,2). The S100B protein has a homodimeric structure comprised of two 91-amino acid polypeptide monomers each with a theoretical molecular weight of 10.5 kDa (1,2). Furthermore, each monomer contains two EF-hand regions, four helixes, and a hinge region (2). S100B is predominately expressed in astrocytes, oligodendrocytes, and Schwann cells, but also other cell types including adipocytes (1,3). S100B interacts with toll-like receptor 4 (TLR4) and receptor for advanced glycation end products (RAGE), initiating downstream signaling cascades and transcription factors including JNK/JUN, NFkappaB, and p38, leading to caspase and proinflammatory cytokine production (2). Overall outcomes include neuronal apoptosis, neuroinflammation, and neurodegeneration (1,2). S100B is the most commonly studied astroglia and blood brain barrier biomarker in traumatic brain injury (TBI) (3,4). The serum levels of S100B in patients with TBI is indicative of patient outcomes, where high levels correlate with injury severity and mortality (4). S100B is often in used in combination with additional biomarkers such as glial fibrillary acidic protein (GFAP) and ubiquitin c-terminal hydrolase L1 (UCH-L1) (3,4).

References

1. Yardan, T., Erenler, A. K., Baydin, A., Aydin, K., & Cokluk, C. (2011). Usefulness of S100B protein in neurological disorders. JPMA. The Journal of the Pakistan Medical Association, 61(3), 276-281.

2. Langeh, U., & Singh, S. (2021). Targeting S100B Protein as a Surrogate Biomarker and its Role in Various Neurological Disorders. Current neuropharmacology, 19(2), 265-277. https://doi.org/10.2174/1570159X18666200729100427

3. Thelin, E. P., Nelson, D. W., & Bellander, B. M. (2017). A review of the clinical utility of serum S100B protein levels in the assessment of traumatic brain injury. Acta neurochirurgica, 159(2), 209-225. https://doi.org/10.1007/s00701-016-3046-3

4. Wang, K. K., Yang, Z., Zhu, T., Shi, Y., Rubenstein, R., Tyndall, J. A., & Manley, G. T. (2018). An update on diagnostic and prognostic biomarkers for traumatic brain injury. Expert review of molecular diagnostics, 18(2), 165-180. https://doi.org/10.1080/14737159.2018.1428089

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB110-58870
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KD, Simple Western, WB
AF3844
Species: Hu, Mu
Applications: IHC
AF3059
Species: Mu
Applications: ICC, Simple Western, WB
AF4117
Species: Rt
Applications: IHC, WB
AF2065
Species: Mu
Applications: ICC, IHC, Simple Western, WB
NBP1-60046
Species: Bv, Eq, Gt, Gp, Hu, Mu, Po, Rb, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KO, WB
AF1356
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
NB100-683
Species: Hu, Mu, Rt
Applications: Dual ISH-IHC, EM, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-94448
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
NBP1-87103
Species: Hu, Mu
Applications: IHC, IHC-P, WB
DRG00
Species: Hu
Applications: ELISA
NBP1-89388
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
H00002023-M01
Species: Fe, Hu
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-P, IP, WB
NBP1-84854
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NB300-653
Species: Ch, Fe, Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-30151
Species: Ca, Hu, Mu
Applications: ICC/IF, IHC, IHC-P
H00006275-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB

Publications for S100B Antibody (NBP1-87102)(14)

We have publications tested in 3 confirmed species: Human, Mouse, Rat.

We have publications tested in 5 applications: ICC/IF, IF/IHC, Immunohistochemistry-Paraffin, WB, Western Blot.


Filter By Application
ICC/IF
(3)
IF/IHC
(3)
Immunohistochemistry-Paraffin
(1)
WB
(1)
Western Blot
(1)
All Applications
Filter By Species
Human
(4)
Mouse
(4)
Rat
(2)
All Species
Showing Publications 1 - 10 of 14. Show All 14 Publications.
Publications using NBP1-87102 Applications Species
Gonzalez H, Narasipura SD, Shull T et al. An Efficient and Cost-Effective Approach to Generate Functional Human Inducible Pluripotent Stem Cell-Derived Astrocytes Cells 2023-09-26 [PMID: 37830571] (ICC/IF, Human) ICC/IF Human
Horowitch B, Lee DY, Ding M et al. Subsets of interferon signaling predict response to immune checkpoint blockade in melanoma patients Clinical cancer research : an official journal of the American Association for Cancer Research 2023-05-26 [PMID: 37233452]
Plebanek, MP;Xue, Y;Nguyen, YV;DeVito, NC;Wang, X;Holtzhausen, A;Beasley, GM;Yarla, N;Thievanthiran, B;Hanks, BA; A SREBF2-dependent gene program drives an immunotolerant dendritic cell population during cancer progression bioRxiv : the preprint server for biology 2023-04-28 [PMID: 37162965] (Immunohistochemistry-Paraffin, Mouse) Immunohistochemistry-Paraffin Mouse
Konstantinidis E, Dakhel A, Beretta C, Erlandsson A Long-term effects of amyloid-beta deposits in human iPSC-derived astrocytes Molecular and cellular neurosciences 2023-03-11 [PMID: 36907531] (Western Blot, Human) Western Blot Human
Theivanthiran B, Yarla N, Haykal T et al. Tumor-intrinsic NLRP3-HSP70-TLR4 axis drives premetastatic niche development and hyperprogression during anti-PD-1 immunotherapy Science Translational Medicine 2022-11-23 [PMID: 36417489]
Bogdanov L, Shishkova D, Mukhamadiyarov R et al. Excessive Adventitial and Perivascular Vascularisation Correlates with Vascular Inflammation and Intimal Hyperplasia International journal of molecular sciences 2022-10-12 [PMID: 36293013] (IF/IHC, Rat)

Details:
Dilution used in IHC 1:100
IF/IHC Rat
ZHOU LN, CUI XJ, SU KX et al. Beneficial reciprocal effects of bone marrow stromal cells and Schwann cells from adult rats in a dynamic co-culture system in vitro without intercellular contact. Mol Med Rep 2015-10-01 [PMID: 26133460] (ICC/IF, Rat, Mouse) ICC/IF Rat, Mouse
Hanson MG, Fregoso V, Vrana JD et al. Peripheral nervous system defects in a mouse model for peroxisomal biogenesis disorders. Dev Biol 2014-11-01 [PMID: 25176044] (IF/IHC, Mouse) IF/IHC Mouse
Kielar M, Tuy FP, Bizzotto S et al. Mutations in Eml1 lead to ectopic progenitors and neuronal heterotopia in mouse and human. Nat Neurosci 2014-07-01 [PMID: 24859200]
Darcy MJ, Trouche S, Jin SX, Feig LA. Age-Dependent Role for Ras-GRF1 in the Late Stages of Adult Neurogenesis in the Dentate Gyrus. Hippocampus 2014-03-01 [PMID: 24174283] (IF/IHC, Mouse) IF/IHC Mouse
Show All 14 Publications.

Reviews for S100B Antibody (NBP1-87102) (0)

There are no reviews for S100B Antibody (NBP1-87102). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for S100B Antibody (NBP1-87102) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional S100B Products

Research Areas for S100B Antibody (NBP1-87102)

Find related products by research area.

Blogs on S100B.

Successful Transplantation of Friedreich Ataxia Induced Pluripotent Stem Cell (iPSC)-Derived Sensory Neurons in Dorsal Root Ganglia of Adult Rodents
Jamshed Arslan, Pharm D, PhD The dorsal root ganglia (DRG) are a collection of cell bodies of sensory nerves carrying sensory information – including nociception, mechanoreception and proprioception – from periphera...  Read full blog post.

Role of GFAP in astrocytes: Lessons from induced pluripotent stem cells in Alexander disease patients
By Michalina Hanzel, PhDAlexander disease is a progressive and fatal neurological disease with phenotypes ranging from myelination abnormalities, gait ataxia and megalencephaly to predisposition to seizures. It is an ...  Read full blog post.

mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our S100B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol S100B