![Immunohistochemistry-Paraffin: RIP140 Antibody [NBP2-13674] - Staining of human Fallopian tube shows moderate nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/RIP140-Antibody-Immunohistochemistry-Paraffin-NBP2-13674-img0007.jpg "Immunohistochemistry-Paraffin: RIP140 Antibody [NBP2-13674] - Staining of human Fallopian tube shows moderate nuclear positivity in glandular cells.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: SSEAHLQQYSREHALKTQNANQAASERLAAMARLQENGQKDVGSYQLPKGMSSHLNGQARTSSSKLMASKSSATVFQNPMGIIPSSPKNAGYKNSLERNNIKQ |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NRIP1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. RIP140 antibody validated for WB from a verified customer review. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Shilpa Agarwal |
WB | Human | 12/09/2014 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for RIP140 Antibody (NBP2-13674)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NRIP1 |
![Immunohistochemistry-Paraffin: RIP140 Antibody [NBP2-13674] - Staining of human duodenum shows moderate nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/RIP140-Antibody-Immunohistochemistry-Paraffin-NBP2-13674-img0004.jpg "Immunohistochemistry-Paraffin: RIP140 Antibody [NBP2-13674] - Staining of human duodenum shows moderate nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: RIP140 Antibody [NBP2-13674] - Staining of human cerebellum shows moderate nuclear positivity in cells in granular layer.](http://images.novusbio.com/fullsize/RIP140-Antibody-Immunohistochemistry-Paraffin-NBP2-13674-img0005.jpg "Immunohistochemistry-Paraffin: RIP140 Antibody [NBP2-13674] - Staining of human cerebellum shows moderate nuclear positivity in cells in granular layer.")
![Immunohistochemistry-Paraffin: RIP140 Antibody [NBP2-13674] - Staining of human skeletal muscle shows weak nuclear positivity in myocytes.](http://images.novusbio.com/fullsize/RIP140-Antibody-Immunohistochemistry-Paraffin-NBP2-13674-img0006.jpg "Immunohistochemistry-Paraffin: RIP140 Antibody [NBP2-13674] - Staining of human skeletal muscle shows weak nuclear positivity in myocytes.")
![Western Blot CBP/KAT3A Antibody (257003) [Unconjugated]](https://images.novusbio.com/images2/CBP_MAB2676_Western_Blot_6043.jpg)
![Immunocytochemistry CBP/KAT3A Antibody (257003) [Unconjugated]](https://images.novusbio.com/images2/mab2676_human-mouse-rat-cbp-mab-clone-257003-immunocytochemistry-101220208237.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
