RBP3 Antibody Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EDNIGYLRFDMFGDGELLTQVSRLLVEHIWKKIMHTDAMIIDMRFNIGGPTSSIPILCSYFFDEGPPVLLDKIYSRPDDSVSELWTHAQVVGERYGSK |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
RBP3 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Reactivity Notes
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for RBP3 Antibody
Background
RBP3, also known as Retinol-binding protein 3, is a secreted 135 kDa 1247 amino acid protein. RBP3 plays a critical role in the visual process by transporting retinoids between the retinal pigment epithelium and the photoreceptors. RBP3 is currently being studied in relationship to retinitis, retinoblastoma, Behcet's disease, diphtheria, night blindness and proliferative vitreoretinopathy. RBP3 is linked to the g1phase, cell cycle, induction of apoptosis, visual cycle I and cell cycle arrest pathways where it interacts with MCPH1, TFDP1, TFDP2, NOTCH1 and RB1.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Bv, Hu, Mu, Po, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: IHC
Publications for RBP3 Antibody (NBP2-58200) (0)
There are no publications for RBP3 Antibody (NBP2-58200).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for RBP3 Antibody (NBP2-58200) (0)
There are no reviews for RBP3 Antibody (NBP2-58200).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for RBP3 Antibody (NBP2-58200) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional RBP3 Products
Research Areas for RBP3 Antibody (NBP2-58200)
Find related products by research area.
|
Blogs on RBP3