Home » Proteasome 20S beta 3 » Proteasome 20S beta 3 Proteins » Proteasome 20S beta 3 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Proteasome 20S beta 3 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Proteasome 20S beta 3 Protein (NBP2-33380PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Proteasome 20S beta 3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PSMB3.

Source: E. coli

Amino Acid Sequence: LYEKRFGPYYTEPVIAGLDPKTFKPFICSLDLIGCPMVTDDFVVSGTCAEQMYGMCESLWEPNMDPDHLFETISQAMLNAVDRD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PSMB3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33380.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Proteasome 20S beta 3 Recombinant Protein Antigen

  • EC 3.4.25.1
  • HC10-II
  • MGC4147
  • proteasome (prosome, macropain) subunit, beta type, 3
  • Proteasome 20S beta 3
  • Proteasome chain 13
  • Proteasome component C10-II
  • proteasome subunit beta type-3
  • Proteasome theta chain
  • PSMB3

Background

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. Pseudogenes have been identified on chromosomes 2 and 12.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

LMP7/PSMB8
Antibody (1B3)
H00005696-M01
Western Blot LMP7/PSMB8 Antibody (1B3)
Immunocytochemistry/ Immunofluorescence LMP7/PSMB8 Antibody (1B3)
Immunohistochemistry-Paraffin LMP7/PSMB8 Antibody (1B3)
(3 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
LMP2/PSMB9
Antibody (OTI1D1)
NBP2-01817
Western Blot LMP2/PSMB9 Antibody (OTI1D1)
Flow Cytometry LMP2/PSMB9 Antibody (OTI1D1)
Immunocytochemistry/ Immunofluorescence LMP2/PSMB9 Antibody (OTI1D1)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
PSMB5 Antibody
NBP2-13820
Immunohistochemistry-Paraffin PSMB5 Antibody
Immunohistochemistry-Paraffin PSMB5 Antibody
Immunohistochemistry-Paraffin PSMB5 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Proteasome 20S
beta2 Antibody
NBP1-92294
Immunohistochemistry-Paraffin Proteasome 20S beta2 Antibody
Immunohistochemistry-Paraffin Proteasome 20S beta2 Antibody
Immunohistochemistry-Paraffin Proteasome 20S beta2 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Proteasome 20S
alpha 5 Antibody
NBP1-32387
Immunohistochemistry-Paraffin Proteasome 20S alpha 5 Antibody
Western Blot Proteasome 20S alpha 5 Antibody
Immunocytochemistry/ Immunofluorescence Proteasome 20S alpha 5 Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Aldo-keto
Reductase 1C1/AKR1C1 ...
MAB6529
Simple Western Aldo-keto Reductase 1C1/AKR1C1 Antibody (859026) [Unconjugated]
Western Blot Aldo-keto Reductase 1C1/AKR1C1 Antibody (859026) [Unconjugated]
(1 Publication)
Species: Hu
Applications: Simple Western, WB
PSMB10/MECL1
Antibody
NBP1-88660
Immunocytochemistry/ Immunofluorescence PSMB10/MECL1 Antibody
Immunohistochemistry-Paraffin PSMB10/MECL1 Antibody
Immunohistochemistry-Paraffin PSMB10/MECL1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
PA28 Activator
alpha Subunit/PSME1 A ...
NBP1-83121
Immunohistochemistry-Paraffin PA28 Activator alpha Subunit/PSME1 Antibody
Western Blot PA28 Activator alpha Subunit/PSME1 Antibody
(4 Publications)
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
STARD3 Antibody
NBP3-17314
Western Blot STARD3 Antibody
Immunocytochemistry/ Immunofluorescence STARD3 Antibody
Species: Hu
Applications: ICC/IF, WB
Nbs1 Antibody
NB100-143
Knockout Validated Nbs1 Antibody
Western Blot Nbs1 Antibody
Knockdown Validated Nbs1 Antibody
(8 Reviews)
(203 Publications)
Species: Ha, Hu, Ma, Mu, Pm
Applications: ChIP, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, ISH, KD, KO, PAGE, WB
PNMT Antibody
(OTI1D2)
NBP2-00688
Western Blot PNMT Antibody (OTI1D2)
Western Blot PNMT Antibody (OTI1D2)
Immunohistochemistry-Paraffin PNMT Antibody (OTI1D2)
(2 Publications)
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Tnk1 Antibody
NBP2-85965
Western Blot Tnk1 Antibody
Immunohistochemistry-Paraffin Tnk1 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
PSMB7 Antibody
(OTI1E1)
NBP2-01832
Western Blot PSMB7 Antibody (OTI1E1)
Immunohistochemistry-Paraffin PSMB7 Antibody (OTI1E1)
Immunohistochemistry-Paraffin PSMB7 Antibody (OTI1E1)
(1 Publication)
Species: Hu, Pm, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
CFTR Antibody
(24-1) [Unconjugated] ...
MAB25031
Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus
Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus
Immunoprecipitation CFTR Antibody (24-1) [Unconjugated] - C-terminus
(10 Reviews)
(76 Publications)
Species: Hu
Applications: IHC, IP, WB
Proteasome 20S
alpha 6 Antibody (OTI ...
NBP2-03836
Flow Cytometry Proteasome 20S alpha 6 Antibody (OTI4C9)
Western Blot Proteasome 20S alpha 6 Antibody (OTI4C9)
Immunohistochemistry-Paraffin Proteasome 20S alpha 6 Antibody (OTI4C9)
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, IHC, IHC-P, WB
Rev-erb A
alpha/NR1D1 Antibody
H00009572-M02
Western Blot Rev-erb A alpha/NR1D1 Antibody (4F6)
Immunohistochemistry-Paraffin Rev-erb A alpha/NR1D1 Antibody (4F6)
Immunohistochemistry Rev-erb A alpha/NR1D1 Antibody (4F6)
(4 Reviews)
(6 Publications)
Species: Hu, Mu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, KD, WB
Proteasome 20S
alpha 3 Antibody
NBP1-92293
Western Blot Proteasome 20S alpha 3 Antibody
Immunocytochemistry/ Immunofluorescence Proteasome 20S alpha 3 Antibody
Immunohistochemistry-Paraffin Proteasome 20S alpha 3 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
PSMA4 Antibody
(OTI4B8)
NBP2-01608
Western Blot PSMA4 Antibody (OTI4B8)
Immunohistochemistry-Paraffin PSMA4 Antibody (OTI4B8)
Immunohistochemistry-Paraffin PSMA4 Antibody (OTI4B8)
Species: Hu, Pm, Mu, Pm, Rt
Applications: IHC, IHC-P, WB

Publications for Proteasome 20S beta 3 Protein (NBP2-33380PEP) (0)

There are no publications for Proteasome 20S beta 3 Protein (NBP2-33380PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Proteasome 20S beta 3 Protein (NBP2-33380PEP) (0)

There are no reviews for Proteasome 20S beta 3 Protein (NBP2-33380PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Proteasome 20S beta 3 Protein (NBP2-33380PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Proteasome 20S beta 3 Products

Blogs on Proteasome 20S beta 3

There are no specific blogs for Proteasome 20S beta 3, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Knockout Validated: Nbs1 Antibody [NB100-143] - Lysates of HeLa human cervical epithelial carcinoma parental cell line and Nbs1 knockout (KO) HeLa cell line. PVDF membrane was probed with 1:1000 of Rabbit Anti-Human Polyclonal [NB100-143] followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (HAF008). Specific band was detected for Nbs1 at approximately 95 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Nbs1 Antibody
NB100-143
CFTR was detected in immersion fixed paraffin-embedded sections of human placenta using 8 µg/mL Mouse Anti-Human CFTR C-Terminus Monoclonal Antibody (Catalog # MAB25031) overnight at 4 °C. Tissue was stained with the Anti-Mouse HRP-AEC Cell & Tissue Staining Kit (red; Catalog # CTS003) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
CFTR Antibody (24-1) [Unconjugated] - C-terminus
MAB25031

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Proteasome 20S beta 3 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol PSMB3