![Western Blot: Tnk1 Antibody [NBP2-85965] - Host: Rabbit. Target Name: TNK1. Antibody Dilution: 1.0ug/ml. Sample Type: RPMI-8226 cell lysateTNK1 is supported by BioGPS gene expression data to be expressed in RPMI 8226](http://images.novusbio.com/fullsize/Tnk1-Antibody-Western-Blot-NBP2-85965-img0002.jpg "Western Blot: Tnk1 Antibody [NBP2-85965] - Host: Rabbit. Target Name: TNK1. Antibody Dilution: 1.0ug/ml. Sample Type: RPMI-8226 cell lysateTNK1 is supported by BioGPS gene expression data to be expressed in RPMI 8226")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Tnk1. Peptide sequence: EIRQARAVPQGPPGLPPRPPLSSSSPQPSQPSRERLPWPKRKPPHNHPMG The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TNK1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
![Immunohistochemistry ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Immunohistochemistry_6703.jpg)
![Western Blot ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Flow_Cytometry_20028.jpg)
![Simple Western ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Simple_Western_20109.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Tnk1 Antibody (NBP2-85965)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TNK1 |
![Immunohistochemistry-Paraffin: Tnk1 Antibody [NBP2-85965] - Rabbit Anti-TNK1 antibody. Formalin Fixed Paraffin Embedded Tissue: Human Adult Skeletal muscle. Observed Staining: Cytoplasm in hepatocytes. Primary Antibody Concentration: 1:600. Secondary Antibody: Donkey anti-Rabbit-Cy3. Secondary Antibody Concentration: 1:200. Magnification: 20X.](http://images.novusbio.com/fullsize/Tnk1-Antibody-Immunohistochemistry-Paraffin-NBP2-85965-img0001.jpg "Immunohistochemistry-Paraffin: Tnk1 Antibody [NBP2-85965] - Rabbit Anti-TNK1 antibody. Formalin Fixed Paraffin Embedded Tissue: Human Adult Skeletal muscle. Observed Staining: Cytoplasm in hepatocytes. Primary Antibody Concentration: 1:600. Secondary Antibody: Donkey anti-Rabbit-Cy3. Secondary Antibody Concentration: 1:200. Magnification: 20X.")
![Immunohistochemistry Clusterin/APOJ Antibody [Unconjugated]](https://images.novusbio.com/images2/Clusterin_AF2747_Immunohistochemistry_9945.jpg)
![Immunohistochemistry Clusterin/APOJ Antibody [Unconjugated]](https://images.novusbio.com/images2/Clusterin_AF2747_Immunohistochemistry_9946.jpg)
![Western Blot Clusterin/APOJ Antibody [Unconjugated]](https://images.novusbio.com/images/af2747_mouse-clusterin-affinity-purified-polyclonal-ab-4120241240247.jpg)
![N/A Cystatin C [HRP]](https://images.novusbio.com/images2/Cystatin_C_MSCTC0_ELISA_321.jpg)
![N/A Cystatin C [HRP]](https://images.novusbio.com/images2/Cystatin_C_MSCTC0_ELISA_322.jpg)
![N/A Cystatin C [HRP]](https://images.novusbio.com/images2/DATA_Cystatin_C_MSCTC0_ELISA_1030.jpg)
![Western Blot GRB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/GRB2_AF3846_Western_Blot_5355.jpg)
![Immunohistochemistry GRB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/GRB2_AF3846_Immunohistochemistry_6809.jpg)
![N/A Coagulation Factor III/Tissue Factor [HRP]](https://images.novusbio.com/images2/DATA_Coagulation_Factor_III_DCF300_ELISA_625.jpg)
![N/A Coagulation Factor III/Tissue Factor [HRP]](https://images.novusbio.com/images2/Coagulation_Factor_III_DCF300_ELISA_61.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
