![Immunocytochemistry/Immunofluorescence: SorCS1 Antibody [NBP1-86096] - Staining of human cell line U-251 MG shows localization to plasma membrane & cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/SorCS1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86096-img0009.jpg "Immunocytochemistry/Immunofluorescence: SorCS1 Antibody [NBP1-86096] - Staining of human cell line U-251 MG shows localization to plasma membrane & cytosol. Antibody staining is shown in green.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KO |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EWRRDIGRVIKKSLVEATGVPGQHILVAVLPGLPTTAELFVLPYQDPAGENKRSTDDLEQISELLIHTLNQNSVHFELKPGVRVLVHAAHLTAAPLVDLT |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SORCS1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Immunohistochemistry_6703.jpg)
![Western Blot ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Flow_Cytometry_20028.jpg)
![Simple Western ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Simple_Western_20109.jpg)
| Publication using NBP1-86096 | Applications | Species |
|---|---|---|
| Subkhangulova A, Malik AR, Hermey G et al. SORCS1 and SORCS3 control energy balance and orexigenic peptide production. EMBO Rep. 2018-04-01 [PMID: 29440124] (WB) | WB |
| Images | Ratings | Applications | Species | Date | Details | ||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
|
reviewed by:
Verified Customer |
WB | Mouse | 12/17/2014 |
Summary
|
|||||||
|
reviewed by:
Verified Customer |
WB | Human | 12/17/2014 |
Summary
|
|||||||
|
reviewed by:
Verified Customer |
IP | Human | 12/17/2014 |
Summary
|
|||||||
|
reviewed by:
Verified Customer |
WB | Human | 12/17/2014 |
Summary
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Verified Customer 12/17/2014 |
||
| Application: | WB | |
| Species: | Mouse |
| Verified Customer 12/17/2014 |
||
| Application: | WB | |
| Species: | Human |
| Verified Customer 12/17/2014 |
||
| Application: | IP | |
| Species: | Human |
| Gene Symbol | SORCS1 |
![Immunohistochemistry-Paraffin: SorCS1 Antibody [NBP1-86096] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/SorCS1-Antibody-Immunohistochemistry-Paraffin-NBP1-86096-img0013.jpg "Immunohistochemistry-Paraffin: SorCS1 Antibody [NBP1-86096] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: SorCS1 Antibody [NBP1-86096] - Staining of human cerebral cortex shows moderate positivity in neuronal processes.](http://images.novusbio.com/fullsize/SorCS1-Antibody-Immunohistochemistry-Paraffin-NBP1-86096-img0010.jpg "Immunohistochemistry-Paraffin: SorCS1 Antibody [NBP1-86096] - Staining of human cerebral cortex shows moderate positivity in neuronal processes.")
![Immunohistochemistry-Paraffin: SorCS1 Antibody [NBP1-86096] - Staining of human small intestine shows strong positivity in apical membrane in glandular cells.](http://images.novusbio.com/fullsize/SorCS1-Antibody-Immunohistochemistry-Paraffin-NBP1-86096-img0011.jpg "Immunohistochemistry-Paraffin: SorCS1 Antibody [NBP1-86096] - Staining of human small intestine shows strong positivity in apical membrane in glandular cells.")
![Immunohistochemistry-Paraffin: SorCS1 Antibody [NBP1-86096] - Staining of human lymph node shows moderate membranous positivity in germinal center cells.](http://images.novusbio.com/fullsize/SorCS1-Antibody-Immunohistochemistry-Paraffin-NBP1-86096-img0012.jpg "Immunohistochemistry-Paraffin: SorCS1 Antibody [NBP1-86096] - Staining of human lymph node shows moderate membranous positivity in germinal center cells.")
![Knockout Validated: SorCS1 Antibody [NBP1-86096] - Altered subcellular localization of TrkB in primary neurons and brains from S1/3 KO mice. Co-immunoprecipitation of SorCS1 with TrkB. TrkB was immunoprecipitated from transiently transfected Chinese hamster ovary cells and the presence of SorCS1 in the immunoprecipitates documented by Western blotting. Panel input shows levels of the indicated proteins in the cell lysates prior to immunoprecipitation. Panel IP documents co-immunoprecipitation of SorCS1 from cells expressing (lanes 3) but not from cells lacking TrkB (lanes 2). The experiment was replicated twice. Image collected and cropped by CiteAb from the following publication (//www.embopress.org/doi/full/10.15252/embr.201744810) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/SorCS1-Antibody-Knockout-Validated-NBP1-86096-img0014.jpg "Knockout Validated: SorCS1 Antibody [NBP1-86096] - Altered subcellular localization of TrkB in primary neurons and brains from S1/3 KO mice. Co-immunoprecipitation of SorCS1 with TrkB. TrkB was immunoprecipitated from transiently transfected Chinese hamster ovary cells and the presence of SorCS1 in the immunoprecipitates documented by Western blotting. Panel input shows levels of the indicated proteins in the cell lysates prior to immunoprecipitation. Panel IP documents co-immunoprecipitation of SorCS1 from cells expressing (lanes 3) but not from cells lacking TrkB (lanes 2). The experiment was replicated twice. Image collected and cropped by CiteAb from the following publication (//www.embopress.org/doi/full/10.15252/embr.201744810) licensed under a CC-BY license.")
![Immunohistochemistry Sortilin Antibody [Unconjugated]](https://images.novusbio.com/images2/Sortilin_AF2934_Immunohistochemistry_7161.jpg)
![Western Blot Sortilin Antibody [Unconjugated]](https://images.novusbio.com/images2/Sortilin_AF2934_Western_Blot_19100.jpg)
![Simple Western Sortilin Antibody [Unconjugated]](https://images.novusbio.com/images2/Sortilin_AF2934_Simple_Western_20098.jpg)
![Immunohistochemistry SorCS2 Antibody [Unconjugated]](https://images.novusbio.com/images2/SorCS2_AF4237_Immunohistochemistry_7174.jpg)
![Immunohistochemistry SorCS2 Antibody [Unconjugated]](https://images.novusbio.com/images2/SorCS2_AF4237_Immunohistochemistry_7175.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_587.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_588.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/BDNF_DBD00_ELISA_36.jpg)
![N/A Coagulation Factor III/Tissue Factor [HRP]](https://images.novusbio.com/images2/DATA_Coagulation_Factor_III_DCF300_ELISA_625.jpg)
![N/A Coagulation Factor III/Tissue Factor [HRP]](https://images.novusbio.com/images2/Coagulation_Factor_III_DCF300_ELISA_61.jpg)
![SDS-PAGE IL-1 beta/IL-1F2 [Unconjugated]](https://images.novusbio.com/images2/IL-1_beta_201-LB_304.jpg)
![Bioactivity IL-1 beta/IL-1F2 [Unconjugated]](https://images.novusbio.com/images2/IL-1_beta_201-LB_306.jpg)
![SEC-MALS IL-1 beta/IL-1F2 [Unconjugated]](https://images.novusbio.com/images/201-lb_recombinant-human-il-1-beta-il-1f2-protein-sec-mals-123202491556.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Immunohistochemistry Clusterin/APOJ Antibody [Unconjugated]](https://images.novusbio.com/images2/Clusterin_AF2747_Immunohistochemistry_9945.jpg)
![Immunohistochemistry Clusterin/APOJ Antibody [Unconjugated]](https://images.novusbio.com/images2/Clusterin_AF2747_Immunohistochemistry_9946.jpg)
![Western Blot Clusterin/APOJ Antibody [Unconjugated]](https://images.novusbio.com/images/af2747_mouse-clusterin-affinity-purified-polyclonal-ab-4120241240247.jpg)
![N/A Cystatin C [HRP]](https://images.novusbio.com/images2/Cystatin_C_MSCTC0_ELISA_321.jpg)
![N/A Cystatin C [HRP]](https://images.novusbio.com/images2/Cystatin_C_MSCTC0_ELISA_322.jpg)
![N/A Cystatin C [HRP]](https://images.novusbio.com/images2/DATA_Cystatin_C_MSCTC0_ELISA_1030.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")