![Western Blot: PORCN Antibody [NBP1-59677] - Sample Tissue: Human Hela Antibody Dilution: 1.0 ug/ml](http://images.novusbio.com/fullsize/PORCN-Antibody-Western-Blot-NBP1-59677-img0005.jpg "Western Blot: PORCN Antibody [NBP1-59677] - Sample Tissue: Human Hela Antibody Dilution: 1.0 ug/ml")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | Synthetic peptides corresponding to PORCN(porcupine homolog (Drosophila)) The peptide sequence was selected from the N terminal of PORCN (NP_073736).
Peptide sequence ACRLLWRLGLPSYLKHASTVAGGFFSLYHFFQLHMVWVVLLSLLCYLVLF. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PORCN |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Theoretical MW | 51 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
| Publications using NBP1-59677 | Applications | Species |
|---|---|---|
| Orzechowska-Licari EJ, Bialkowska AB, Yang VW Sonic Hedgehog and WNT signaling regulate a positive feedback loop between intestinal epithelial and stromal cells to promote epithelial regeneration Cellular and molecular gastroenterology and hepatology 2023-07-20 [PMID: 37481204] Details: 1:400 WB dilution |
||
| Mohamed R, Kennedy C, Willmore WG Responses of porcupine and Wntless proteins to oxidative, hypoxic and endoplasmic reticulum stresses Cellular signalling 2021-05-17 [PMID: 34015469] (WB) | WB | |
| Sheng J Cellular Effects Nanosilver on Cancer and Non-cancer Cells: Potential Environmental and Human Health Impacts Thesis | ||
| Clinch M The Role of Hypoxia on PORCN and WLS Expression in Human Embryonic Kidney (HEK293T) and Human Colon Cancer (HCT-116T) Cells Carleton University 2022-04-05 (WB, Human) | WB | Human |
| Cameron S Anti-Cancer and Stress Response Pathway Effects of Nanosilver and Sodium Ascorbate Carleton University 2022-07-11 (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry: PORCN Antibody [NBP1-59677] - SampleType: Mouse Uterus - Dilution 1 in 300. - secondary antibody dilution 1 in 1000.](http://images.novusbio.com/fullsize/PORCN-Antibody-Immunohistochemistry-NBP1-59677-img0006.jpg "Immunohistochemistry: PORCN Antibody [NBP1-59677] - SampleType: Mouse Uterus - Dilution 1 in 300. - secondary antibody dilution 1 in 1000.")
![Western Blot: PORCN Antibody [NBP1-59677] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.](http://images.novusbio.com/fullsize/PORCN-Antibody-Western-Blot-NBP1-59677-img0003.jpg "Western Blot: PORCN Antibody [NBP1-59677] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.")
![Western Blot: PORCN Antibody [NBP1-59677] - Sample Tissue: Hela Whole cell, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, Lysate Quantity: 25ug/lane, Gel Concentration: 0.12%](http://images.novusbio.com/fullsize/PORCN-Antibody-Western-Blot-NBP1-59677-img0004.jpg "Western Blot: PORCN Antibody [NBP1-59677] - Sample Tissue: Hela Whole cell, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, Lysate Quantity: 25ug/lane, Gel Concentration: 0.12%")
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")