![Western Blot: CYP21A2 Antibody [NBP2-13893] - Analysis in human adrenal gland tissue.](http://images.novusbio.com/fullsize/CYP21A2-Antibody-Western-Blot-NBP2-13893-img0005.jpg "Western Blot: CYP21A2 Antibody [NBP2-13893] - Analysis in human adrenal gland tissue.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: GLTQKFGPIYRLHLGLQDVVVLNSKRTIEEAMVKKWADFAGRPEPLTYKLVSRNYPDLSLGDYSLLW |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CYP21A2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control |
|
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for CYP21A2 Antibody (NBP2-13893)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CYP21A2 |
![Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/CYP21A2-Antibody-Immunohistochemistry-Paraffin-NBP2-13893-img0020.jpg "Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.")
![Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize/CYP21A2-Antibody-Immunohistochemistry-Paraffin-NBP2-13893-img0012.jpg "Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893] - Staining of human cerebral cortex.")
![Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893] - Staining of human testis.](http://images.novusbio.com/fullsize/CYP21A2-Antibody-Immunohistochemistry-Paraffin-NBP2-13893-img0013.jpg "Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893] - Staining of human testis.")
![Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893] - Staining of human kidney.](http://images.novusbio.com/fullsize/CYP21A2-Antibody-Immunohistochemistry-Paraffin-NBP2-13893-img0014.jpg "Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893] - Staining of human kidney.")
![Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893] - Staining of human adrenal gland using Anti-CYP21A2 antibody NBP2-13893.](http://images.novusbio.com/fullsize/CYP21A2-Antibody-Immunohistochemistry-Paraffin-NBP2-13893-img0015.jpg "Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893] - Staining of human adrenal gland using Anti-CYP21A2 antibody NBP2-13893.")
![Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893] - Staining of human adrenal gland, kidney, pancreas and testis using Anti-CYP21A2 antibody NBP2-13893 (A) shows similar protein distribution across tissues to independent antibody NBP2-38698 (B).](http://images.novusbio.com/fullsize/CYP21A2-Antibody-Immunohistochemistry-Paraffin-NBP2-13893-img0016.jpg "Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893] - Staining of human adrenal gland, kidney, pancreas and testis using Anti-CYP21A2 antibody NBP2-13893 (A) shows similar protein distribution across tissues to independent antibody NBP2-38698 (B).")
![Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893] - Analysis in human adrenal gland and kidney tissues using NBP2-13893 antibody. Corresponding CYP21A2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/CYP21A2-Antibody-Immunohistochemistry-Paraffin-NBP2-13893-img0017.jpg "Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893] - Analysis in human adrenal gland and kidney tissues using NBP2-13893 antibody. Corresponding CYP21A2 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893] - Staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells in adrenal cortex.](http://images.novusbio.com/fullsize/CYP21A2-Antibody-Immunohistochemistry-Paraffin-NBP2-13893-img0018.jpg "Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893] - Staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells in adrenal cortex.")
![Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.](http://images.novusbio.com/fullsize/CYP21A2-Antibody-Immunohistochemistry-Paraffin-NBP2-13893-img0019.jpg "Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.")
![Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893] - Staining of human kidney shows no positivity in cells in tubules as expected.](http://images.novusbio.com/fullsize/CYP21A2-Antibody-Immunohistochemistry-Paraffin-NBP2-13893-img0021.jpg "Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893] - Staining of human kidney shows no positivity in cells in tubules as expected.")
![Western Blot Tenascin X Antibody [Unconjugated]](https://images.novusbio.com/images2/Tenascin_X_AF6999_Western_Blot_11365.jpg)
![Immunohistochemistry Tenascin X Antibody [Unconjugated]](https://images.novusbio.com/images2/Tenascin_X_AF6999_Immunohistochemistry_11545.jpg)
![Simple Western Tenascin X Antibody [Unconjugated]](https://images.novusbio.com/images2/Tenascin_X_AF6999_Simple_Western_20232.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")