Home » PFDN5 » PFDN5 Proteins » PFDN5 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

PFDN5 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for PFDN5 Protein (NBP1-82639PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

PFDN5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PFDN5.

Source: E. coli

Amino Acid Sequence: INITELNLPQLEMLKNQLDQEVEFLSTSIAQLKVVQTKYVEAKDCLNVLNKSNEGKELLVPLTSSMYVPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAVMEMMSQKIQQLTA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PFDN5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82639.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PFDN5 Recombinant Protein Antigen

  • c-myc binding protein
  • C-Myc-binding protein Mm-1
  • MM-1
  • MM1MGC71907
  • Myc modulator 1
  • myc modulator-1
  • PFD5MGC5329
  • prefoldin 5
  • prefoldin subunit 5

Background

PFDN5 encodes a member of the prefoldin alpha subunit family. The encoded protein is one of six subunits of prefoldin, a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly. The complex, consisting of two alpha and four beta subunits, forms a double beta barrel assembly with six protruding coiled-coils. The encoded protein may also repress the transcriptional activity of the proto-oncogene c-Myc. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PrPC Antibody
NB100-56605
Western Blot PrPC Antibody
Species: Av, Bv, Sh
Applications: WB
c-Myc Antibody
(9E10) - BSA Free
NB600-302
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Western Blot c-Myc Antibody (9E10) - BSA Free
(4 Reviews)
(46 Publications)
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
MYCBP Antibody
(2E9)
H00026292-M02
Immunocytochemistry/ Immunofluorescence MYCBP Antibody (2E9)
ELISA MYCBP Antibody (2E9)
Immunohistochemistry-Paraffin MYCBP Antibody (2E9)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Choline kinase
alpha Antibody
NBP1-85630
Western Blot Choline kinase alpha Antibody
Immunohistochemistry-Paraffin Choline kinase alpha Antibody
Immunohistochemistry-Paraffin Choline kinase alpha Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
Choline Kinase
beta [Unconjugated]
8184-CK
Choline Kinase beta [Unconjugated]
Species: Hu
Applications: EnzAct
Myoglobin Antibody
[Unconjugated]
G-125-C
Myoglobin Antibody [Unconjugated]
Species: Hu
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(667 Publications)
Species: Mu
Applications: ELISA
ABCB6 Antibody
NBP3-41339
Western Blot ABCB6 Antibody
Immunohistochemistry-Paraffin ABCB6 Antibody
Immunohistochemistry-Paraffin ABCB6 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Peroxiredoxin 2
Antibody (4E10-2D2)
H00007001-M01
ELISA Peroxiredoxin 2 Antibody (4E10-2D2)
Western Blot Peroxiredoxin 2 Antibody (4E10-2D2)
Western Blot Peroxiredoxin 2 Antibody (4E10-2D2)
(1 Review)
(6 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
KAP1 [p Ser824]
Antibody
NB100-2350
Immunohistochemistry-Paraffin KAP1 [p Ser824] Antibody
Immunohistochemistry-Paraffin KAP1 [p Ser824] Antibody
Immunocytochemistry/ Immunofluorescence KAP1 [p Ser824] Antibody
(1 Review)
(37 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
CARD14 Antibody -
Azide and BSA Free
NBP2-92873
Western Blot CARD14 Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
C4 binding protein
A Antibody
NBP1-88262
Western Blot C4 binding protein A Antibody
Immunohistochemistry-Paraffin C4 binding protein A Antibody
Immunohistochemistry-Paraffin C4 binding protein A Antibody
Species: Hu
Applications: IHC, IHC-P, WB
PSMB5 Antibody
NBP2-13820
Immunohistochemistry-Paraffin PSMB5 Antibody
Immunohistochemistry-Paraffin PSMB5 Antibody
Immunohistochemistry-Paraffin PSMB5 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
CD79A Antibody
(HM57)
NB100-64347
Flow Cytometry CD79A Antibody (HM57)
Immunohistochemistry CD79A Antibody (HM57)
Immunohistochemistry-Paraffin CD79A Antibody (HM57)
(2 Reviews)
(6 Publications)
Species: Hu
Applications: Flow, IHC, IHC-Fr, IHC-P
PNMA2 Antibody
NBP1-82806
Immunohistochemistry-Paraffin PNMA2 Antibody
Immunohistochemistry-Paraffin PNMA2 Antibody
Immunohistochemistry-Paraffin PNMA2 Antibody
(3 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
CDKN3 Antibody
(OTI2E11)
NBP2-01245
Flow Cytometry CDKN3 Antibody (OTI2E11)
Flow Cytometry CDKN3 Antibody (OTI2E11)
Western Blot CDKN3 Antibody (OTI2E11)
(1 Publication)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
HDAC1 Antibody
NB100-56340
Western Blot HDAC1 Antibody
Simple Western HDAC1 Antibody
Western Blot HDAC1 Antibody
(2 Reviews)
(19 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
EGR1 Antibody
[Unconjugated]
AF2818
Immunocytochemistry EGR1 Antibody [Unconjugated]
(13 Publications)
Species: Hu
Applications: ICC, WB
Max Antibody
NB100-793
Immunohistochemistry-Paraffin Max Antibody
Immunofluorescence Max Antibody
Immunofluorescence Max Antibody
(3 Publications)
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
PFDN5 Recombinant
Protein Antigen
NBP1-82639PEP
PFDN5 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for PFDN5 Protein (NBP1-82639PEP) (0)

There are no publications for PFDN5 Protein (NBP1-82639PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PFDN5 Protein (NBP1-82639PEP) (0)

There are no reviews for PFDN5 Protein (NBP1-82639PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PFDN5 Protein (NBP1-82639PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PFDN5 Products

Research Areas for PFDN5 Protein (NBP1-82639PEP)

Find related products by research area.

Blogs on PFDN5

There are no specific blogs for PFDN5, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Flow Cytometry: c-Myc Antibody (9E10) [NB600-302] - An intracellular stain was performed on U-937 cells with c-Myc Antibody (9E10) NB600-302AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
c-Myc Antibody (9E10) - BSA Free
NB600-302

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PFDN5 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol PFDN5