![Western Blot: Choline kinase alpha Antibody [NBP1-85630] - Analysis in human cell lines SK-MEL-30 and U-251MG using anti-CHKA antibody. Corresponding CHKA RNA-seq data are presented for the same cell lines. Loading control: anti-HDAC1.](http://images.novusbio.com/fullsize/Choline-kinase-alpha-Antibody-Western-Blot-NBP1-85630-img0008.jpg "Western Blot: Choline kinase alpha Antibody [NBP1-85630] - Analysis in human cell lines SK-MEL-30 and U-251MG using anti-CHKA antibody. Corresponding CHKA RNA-seq data are presented for the same cell lines. Loading control: anti-HDAC1.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FDIGNHFCEWMYDYSYEKYPFFRANIRKYPTKKQQLHFISSYLPAFQNDFENLSTEEKSIIKEEMLLEVNRFALASHFLWGLWSIVQAKIS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CHKA |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Myoglobin Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Myoglobin Antibody [Unconjugated]")
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Choline kinase alpha Antibody (NBP1-85630)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: Choline kinase alpha Antibody [NBP1-85630] - Staining of human gastrointestinal shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/Choline-kinase-alpha-Antibody-Immunohistochemistry-Paraffin-NBP1-85630-img0014.jpg "Immunohistochemistry-Paraffin: Choline kinase alpha Antibody [NBP1-85630] - Staining of human gastrointestinal shows moderate cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Choline kinase alpha Antibody [NBP1-85630] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/Choline-kinase-alpha-Antibody-Immunohistochemistry-Paraffin-NBP1-85630-img0010.jpg "Immunohistochemistry-Paraffin: Choline kinase alpha Antibody [NBP1-85630] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.")
![Immunohistochemistry-Paraffin: Choline kinase alpha Antibody [NBP1-85630] - Staining of human cervix shows moderate to strong positivity in mucus in glandular cells.](http://images.novusbio.com/fullsize/Choline-kinase-alpha-Antibody-Immunohistochemistry-Paraffin-NBP1-85630-img0011.jpg "Immunohistochemistry-Paraffin: Choline kinase alpha Antibody [NBP1-85630] - Staining of human cervix shows moderate to strong positivity in mucus in glandular cells.")
![Immunohistochemistry-Paraffin: Choline kinase alpha Antibody [NBP1-85630] - Staining of human testis shows weak to moderate positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/Choline-kinase-alpha-Antibody-Immunohistochemistry-Paraffin-NBP1-85630-img0013.jpg "Immunohistochemistry-Paraffin: Choline kinase alpha Antibody [NBP1-85630] - Staining of human testis shows weak to moderate positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: Choline kinase alpha Antibody [NBP1-85630] - Staining of human lymphoid tissues shows moderate cytoplasmic positivity in lymphoid cells.](http://images.novusbio.com/fullsize/Choline-kinase-alpha-Antibody-Immunohistochemistry-Paraffin-NBP1-85630-img0012.jpg "Immunohistochemistry-Paraffin: Choline kinase alpha Antibody [NBP1-85630] - Staining of human lymphoid tissues shows moderate cytoplasmic positivity in lymphoid cells.")
![N/A C-Reactive Protein/CRP [Biotin]](https://images.novusbio.com/images2/DATA_CReactive_Protein_DY1707_ELISA_1701.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")