![Immunohistochemistry-Paraffin: PERP Antibody [NBP1-85173] - Staining of human esophagus shows very weak membranous positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/PERP-Antibody-Immunohistochemistry-Paraffin-NBP1-85173-img0010.jpg "Immunohistochemistry-Paraffin: PERP Antibody [NBP1-85173] - Staining of human esophagus shows very weak membranous positivity in squamous epithelial cells.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LQSSDHGQTSSLWWKCSQEGGGSGSYEEGCQSLMEYAW |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PERP |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for PERP Antibody (NBP1-85173)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PERP |
![Immunohistochemistry-Paraffin: PERP Antibody [NBP1-85173] - Analysis in human skin and skeletal muscle tissues. Corresponding PERP RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/PERP-Antibody-Immunohistochemistry-Paraffin-NBP1-85173-img0006.jpg "Immunohistochemistry-Paraffin: PERP Antibody [NBP1-85173] - Analysis in human skin and skeletal muscle tissues. Corresponding PERP RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: PERP Antibody [NBP1-85173] - Staining of human skin shows moderate to strong membranous positivity in stratum corneum.](http://images.novusbio.com/fullsize/PERP-Antibody-Immunohistochemistry-Paraffin-NBP1-85173-img0007.jpg "Immunohistochemistry-Paraffin: PERP Antibody [NBP1-85173] - Staining of human skin shows moderate to strong membranous positivity in stratum corneum.")
![Immunohistochemistry-Paraffin: PERP Antibody [NBP1-85173] - Staining of human lymph node shows no positivity as expected.](http://images.novusbio.com/fullsize/PERP-Antibody-Immunohistochemistry-Paraffin-NBP1-85173-img0008.jpg "Immunohistochemistry-Paraffin: PERP Antibody [NBP1-85173] - Staining of human lymph node shows no positivity as expected.")
![Immunohistochemistry-Paraffin: PERP Antibody [NBP1-85173] - Staining of human endometrium shows no positivity as expected.](http://images.novusbio.com/fullsize/PERP-Antibody-Immunohistochemistry-Paraffin-NBP1-85173-img0009.jpg "Immunohistochemistry-Paraffin: PERP Antibody [NBP1-85173] - Staining of human endometrium shows no positivity as expected.")
![Immunohistochemistry-Paraffin: PERP Antibody [NBP1-85173] - Staining of human skeletal muscle shows no positivity as expected.](http://images.novusbio.com/fullsize/PERP-Antibody-Immunohistochemistry-Paraffin-NBP1-85173-img0011.jpg "Immunohistochemistry-Paraffin: PERP Antibody [NBP1-85173] - Staining of human skeletal muscle shows no positivity as expected.")
![Immunohistochemistry p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images2/p63_AF1916_Immunohistochemistry_16919.jpg)
![Immunocytochemistry p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images2/p63_AF1916_Immunocytochemistry__Immunofluorescence_16973.jpg)
![Immunocytochemistry/ Immunofluorescence p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images/af1916_human-p63-tp73l-affinity-purified-polyclonal-ab-41202412401237.jpg)
![Immunocytochemistry CKAP4/p63 Antibody [Unconjugated]](https://images.novusbio.com/images2/CKAP4_AF7355_Immunocytochemistry__Immunofluorescence_17000.jpg)
![Western Blot CKAP4/p63 Antibody [Unconjugated]](https://images.novusbio.com/images2/CKAP4_AF7355_Western_Blot_11997.jpg)
![Immunocytochemistry CKAP4/p63 Antibody [Unconjugated]](https://images.novusbio.com/images2/CKAP4_AF7355_Immunocytochemistry_12002.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")