![Western Blot: PERP Antibody (1O3L5) [NBP3-16617] - Western blot analysis of extracts of various cell lines, using PERP Rabbit mAb (NBP3-16617) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.](http://images.novusbio.com/fullsize/PERP-Antibody-1O3L5-Western-Blot-NBP3-16617-img0005.jpg "Western Blot: PERP Antibody (1O3L5) [NBP3-16617] - Western blot analysis of extracts of various cell lines, using PERP Rabbit mAb (NBP3-16617) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC |
| Clone | 1O3L5 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 94-193 of human PERP (Q96FX8). LSFFALCGPQMLVFLRVIGGLLALAAVFQIISLVIYPVKYTQTFTLHANPAVTYIYNWAYGFGWAATIILIGCAFFFCCLPNYEDDLLGNAKPRYFYTSA |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | PERP |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 21 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for PERP Antibody (NBP3-16617)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PERP |
![Immunohistochemistry: PERP Antibody (1O3L5) [NBP3-16617] - Immunofluorescence analysis of mouse skin cells using PERP Rabbit mAb (NBP3-16617) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/PERP-Antibody-1O3L5-Immunohistochemistry-NBP3-16617-img0004.jpg "Immunohistochemistry: PERP Antibody (1O3L5) [NBP3-16617] - Immunofluorescence analysis of mouse skin cells using PERP Rabbit mAb (NBP3-16617) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Western Blot: PERP Antibody (1O3L5) [NBP3-16617] - Western blot analysis of extracts of various cell lines, using PERP Rabbit mAb (NBP3-16617) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.](http://images.novusbio.com/fullsize/PERP-Antibody-1O3L5-Western-Blot-NBP3-16617-img0006.jpg "Western Blot: PERP Antibody (1O3L5) [NBP3-16617] - Western blot analysis of extracts of various cell lines, using PERP Rabbit mAb (NBP3-16617) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.")
![Immunohistochemistry-Paraffin: PERP Antibody (1O3L5) [NBP3-16617] - Immunohistochemistry of paraffin-embedded rat skin using PERP Rabbit mAb (NBP3-16617) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/PERP-Antibody-1O3L5-Immunohistochemistry-Paraffin-NBP3-16617-img0001.jpg "Immunohistochemistry-Paraffin: PERP Antibody (1O3L5) [NBP3-16617] - Immunohistochemistry of paraffin-embedded rat skin using PERP Rabbit mAb (NBP3-16617) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: PERP Antibody (1O3L5) [NBP3-16617] - Immunohistochemistry of paraffin-embedded mouse skin using PERP Rabbit mAb (NBP3-16617) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/PERP-Antibody-1O3L5-Immunohistochemistry-Paraffin-NBP3-16617-img0002.jpg "Immunohistochemistry-Paraffin: PERP Antibody (1O3L5) [NBP3-16617] - Immunohistochemistry of paraffin-embedded mouse skin using PERP Rabbit mAb (NBP3-16617) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.")
![Immunohistochemistry: PERP Antibody (1O3L5) [NBP3-16617] - Immunofluorescence analysis of human skin cells using PERP Rabbit mAb (NBP3-16617) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/PERP-Antibody-1O3L5-Immunohistochemistry-NBP3-16617-img0003.jpg "Immunohistochemistry: PERP Antibody (1O3L5) [NBP3-16617] - Immunofluorescence analysis of human skin cells using PERP Rabbit mAb (NBP3-16617) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunocytochemistry/ Immunofluorescence: PERP Antibody (1O3L5) [NBP3-16617] - Immunofluorescence analysis of paraffin-embedded mouse skin using PERP Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-16617_rabbit-perp-mab-1o3l5-52202511383748.jpg "Immunocytochemistry/ Immunofluorescence: PERP Antibody (1O3L5) [NBP3-16617] - Immunofluorescence analysis of paraffin-embedded mouse skin using PERP Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Immunocytochemistry/ Immunofluorescence: PERP Antibody (1O3L5) [NBP3-16617] - Immunofluorescence analysis of paraffin-embedded human skin using PERP Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-16617_rabbit-perp-mab-1o3l5-52202511374129.jpg "Immunocytochemistry/ Immunofluorescence: PERP Antibody (1O3L5) [NBP3-16617] - Immunofluorescence analysis of paraffin-embedded human skin using PERP Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Immunocytochemistry/ Immunofluorescence: PERP Antibody (1O3L5) [PERP] - Immunofluorescence analysis of paraffin-embedded mouse skin using PERP Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-16617_rabbit-perp-mab-1o3l5-522025173457.jpg "Immunocytochemistry/ Immunofluorescence: PERP Antibody (1O3L5) [PERP] - Immunofluorescence analysis of paraffin-embedded mouse skin using PERP Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Immunocytochemistry/ Immunofluorescence: PERP Antibody (1O3L5) [PERP] - Immunofluorescence analysis of paraffin-embedded human skin using PERP Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-16617_rabbit-perp-mab-1o3l5-52202517304962.jpg "Immunocytochemistry/ Immunofluorescence: PERP Antibody (1O3L5) [PERP] - Immunofluorescence analysis of paraffin-embedded human skin using PERP Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Immunohistochemistry p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images2/p63_AF1916_Immunohistochemistry_16919.jpg)
![Immunocytochemistry p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images2/p63_AF1916_Immunocytochemistry__Immunofluorescence_16973.jpg)
![Immunocytochemistry/ Immunofluorescence p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images/af1916_human-p63-tp73l-affinity-purified-polyclonal-ab-41202412401237.jpg)
![Immunocytochemistry CKAP4/p63 Antibody [Unconjugated]](https://images.novusbio.com/images2/CKAP4_AF7355_Immunocytochemistry__Immunofluorescence_17000.jpg)
![Western Blot CKAP4/p63 Antibody [Unconjugated]](https://images.novusbio.com/images2/CKAP4_AF7355_Western_Blot_11997.jpg)
![Immunocytochemistry CKAP4/p63 Antibody [Unconjugated]](https://images.novusbio.com/images2/CKAP4_AF7355_Immunocytochemistry_12002.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")