Novus Biologicals products are now on bio-techne.com

Perilipin-3/TIP47 Recombinant Protein Antigen

Images

 
There are currently no images for Perilipin-3/TIP47 Recombinant Protein Antigen (NBP2-49485PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Perilipin-3/TIP47 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Perilipin-3/TIP47.

Source: E. coli

Amino Acid Sequence: DKTKSVVTGGVQSVMGSRLGQMVLSGVDTVLGKSEEWADNHLPLTDAELARIATSLDGFDVASVQQQRQEQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PLIN3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49485.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Perilipin-3/TIP47 Recombinant Protein Antigen

  • Cargo selection protein TIP47
  • M6PRBP1
  • M6PRBP1MGC2012
  • Mannose-6-phosphate receptor-binding protein 1
  • perilipin 3,47 kDa MPR-binding protein
  • Perilipin3
  • Perilipin-3
  • Placental protein 17,47 kDa mannose 6-phosphate receptor-binding protein
  • PLIN3
  • PP17
  • PP17MGC11117
  • tail-interacting protein, 47 kD
  • TIP47
  • TIP47mannose-6-phosphate receptor binding protein 1

Background

TIP47 has been described as cargo protein involved in the trafficking of the mannose-6-phosphate receptor between endosomes and the Golgi complex. Mannose 6-phophate receptors (MPRs) deliver lysosomal hydrolase from the Golgi to endosomes and then return to the Golgi complex. The protein encoded by this gene interacts with the cytoplasmic domains of both cation-independent and cation-dependent MPRs, and is required for endosome-to-Golgi transport. This protein also binds directly to the GTPase RAB9 (RAB9A), a member of the RAS oncogene family. The interaction with RAB9 has been shown to increase the affinity of this protein for its cargo. PLIN3 has been localized in milk fat globule membranes of human and bovine origin. It has also been described as a placental protein. Increased amounts of TIP47 are secreted into circulation of cervix carcinoma patients. Therefore, TIP47 is probably significant as an oncodevelopmental marker.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-40877
Species: Bv, Hu, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NB110-40760
Species: Fi, Hu, Mu, Po, Rt
Applications: Flow, IMC, ICC/IF, IHC, IHC-P, WB
NB110-60509
Species: Bv, Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
AF6989
Species: Mu
Applications: IHC
H00342184-M07
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-13776
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
H00009367-M01
Species: Hu
Applications: ELISA, ICC/IF, KD, S-ELISA, WB
AF5365
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NB110-37253
Species: Hu, Mu, Rt
Applications: WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
NBP1-83220
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
NB300-537
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
AF2214
Species: Hu
Applications: ICC, IHC, WB
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF5320
Species: Hu
Applications: WB
NBP2-49485PEP
Species: Hu
Applications: AC

Publications for Perilipin-3/TIP47 Recombinant Protein Antigen (NBP2-49485PEP) (0)

There are no publications for Perilipin-3/TIP47 Recombinant Protein Antigen (NBP2-49485PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Perilipin-3/TIP47 Recombinant Protein Antigen (NBP2-49485PEP) (0)

There are no reviews for Perilipin-3/TIP47 Recombinant Protein Antigen (NBP2-49485PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Perilipin-3/TIP47 Recombinant Protein Antigen (NBP2-49485PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Perilipin-3/TIP47 Products

Research Areas for Perilipin-3/TIP47 Recombinant Protein Antigen (NBP2-49485PEP)

Find related products by research area.

Blogs on Perilipin-3/TIP47

There are no specific blogs for Perilipin-3/TIP47, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Perilipin Antibody
NB110-40760

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Perilipin-3/TIP47 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PLIN3