Home » PDGF R beta » PDGF R beta Proteins » PDGF R beta Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

PDGF R beta Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for PDGF R beta Protein (NBP1-88134PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

PDGF R beta Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PDGFRB.

Source: E. coli

Amino Acid Sequence: AQDGTFSSVLTLTNLTGLDTGEYFCTHNDSRGLETDERKRLYIFVPDPTVGFLPNDAEELFIFLTEITEITIPCRVTDPQLVVTLHEKKGDVAL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PDGFRB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88134.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PDGF R beta Recombinant Protein Antigen

  • beta-type platelet-derived growth factor receptor
  • CD140 antigen-like family member B
  • CD140b antigen
  • CD140b
  • EC 2.7.10
  • EC 2.7.10.1
  • JTK12
  • PDGF R beta
  • PDGFR
  • PDGFR1
  • PDGFRB
  • PDGF-R-beta
  • platelet-derived growth factor receptor, beta polypeptide

Background

Human platelet-derived growth factor (PDGF) receptor, is a receptor tyrosine kinase whose activity induces various signalling cascades leading to cell growth and proliferation. Two major isoforms exist, PDGF receptor-alpha and PDGF receptor-beta. PDGF receptor-beta can only bind two specific PDGF isoforms, PDGF-beta and PDGF-delta (1,2). Upon ligand binding, the receptor undergoes autophosphorylation, allowing binding and activation of cytoplasmic SH2 domain-containing signal transduction molecules such as PI kinase (3), Grb2, and Src, among others.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

CD117/c-kit
Antibody [Unconjugate
AF1356
Simple Western CD117/c-kit Antibody [Unconjugated]
Western Blot CD117/c-kit Antibody [Unconjugated]
Immunohistochemistry CD117/c-kit Antibody [Unconjugated]
(4 Reviews)
(116 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
EGFR Antibody
[Unconjugated]
AF231
Immunohistochemistry EGFR Antibody [Unconjugated]
Immunocytochemistry EGFR Antibody [Unconjugated]
Western Blot EGFR Antibody [Unconjugated]
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
PDGFR alpha
Antibody [Unconjugate
AF1062
Western Blot PDGFR alpha Antibody [Unconjugated]
Immunohistochemistry PDGFR alpha Antibody [Unconjugated]
Neutralization PDGFR alpha Antibody [Unconjugated]
(4 Reviews)
(298 Publications)
Species: Mu
Applications: Flow, IHC, Neut, WB
VEGFR2/KDR/Flk-1
Antibody [Unconjugate ...
AF644
Neutralization VEGFR2/KDR/Flk-1 Antibody [Unconjugated]
Immunohistochemistry VEGFR2/KDR/Flk-1 Antibody [Unconjugated]
Immunohistochemistry VEGFR2/KDR/Flk-1 Antibody [Unconjugated]
(3 Reviews)
(98 Publications)
Species: Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Neut, WB
VEGF [HRP]
DVE00
N/A VEGF [HRP]
N/A VEGF [HRP]
N/A VEGF [HRP]
(684 Publications)
Species: Hu
Applications: ELISA
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(49 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
c-Abl Antibody
[Unconjugated]
AF5414
Western Blot c-Abl Antibody [Unconjugated]
Simple Western c-Abl Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: Simple Western, WB
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western Blot Src [p Tyr419] Antibody [Unconjugated]
Simple Western Src [p Tyr419] Antibody [Unconjugated]
Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]
(1 Review)
(10 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
FGFR1 Antibody
(M19B2) - BSA Free
NB600-1287
Flow Cytometry FGFR1 Antibody (M19B2) - BSA Free
Flow Cytometry FGFR1 Antibody (M19B2) - BSA Free
Western Blot FGFR1 Antibody (M19B2) - BSA Free
(1 Review)
(7 Publications)
Species: Ca, Hu, Mu, Rb, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
PDGF-B Antibody
NBP1-58279
Knockdown Validated PDGF-B Antibody
Immunocytochemistry/ Immunofluorescence PDGF-B Antibody
Western Blot PDGF-B Antibody
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Flt-3/Flk-2/CD135
Antibody (66903) [Unc ...
MAB812
Flow Cytometry Flt-3/Flk-2/CD135 Antibody (66903) [Unconjugated]
Flow Cytometry Flt-3/Flk-2/CD135 Antibody (66903) [Unconjugated]
(4 Publications)
Species: Hu
Applications: CyTOF-ready, Flow
PDGF-AA
[Unconjugated]
221-AA
Bioactivity PDGF-AA [Unconjugated]
Cell Culture PDGF-AA [Unconjugated]
(57 Publications)
Species: Hu
Applications: BA
EGF [Unconjugated]
236-EG
SDS-PAGE EGF [Unconjugated]
Bioactivity EGF [Unconjugated]
Cell Culture EGF [Unconjugated]
(842 Publications)
Species: Hu
Applications: BA
PIK3CA Antibody
NBP2-19804
Western Blot PIK3CA Antibody
Immunohistochemistry-Paraffin PIK3CA Antibody
Western Blot PIK3CA Antibody
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
PI 3-Kinase p110
beta/PIK3CB Antibody ...
MAB2686
Western Blot PI 3-Kinase p110 beta/PIK3CB Antibody (269020)
(5 Publications)
Species: Hu
Applications: WB
PI 3-Kinase p110
gamma Antibody
NBP2-15071
Western Blot PI 3-Kinase p110 gamma Antibody
Western Blot PI 3-Kinase p110 gamma Antibody
Immunohistochemistry-Paraffin PI 3-Kinase p110 gamma Antibody
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB

Publications for PDGF R beta Protein (NBP1-88134PEP) (0)

There are no publications for PDGF R beta Protein (NBP1-88134PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDGF R beta Protein (NBP1-88134PEP) (0)

There are no reviews for PDGF R beta Protein (NBP1-88134PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PDGF R beta Protein (NBP1-88134PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PDGF R beta Products

Research Areas for PDGF R beta Protein (NBP1-88134PEP)

Find related products by research area.

Blogs on PDGF R beta

There are no specific blogs for PDGF R beta, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PDGF R beta Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol PDGFRB