![Immunocytochemistry/Immunofluorescence: PCGF6 Antibody (2B8) [H00084108-M01] - Analysis of monoclonal antibody to PCGF6 on HeLa cell . Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize/PCGF6-Antibody-2B8-Immunocytochemistry-Immunofluorescence-H00084108-M01-img0002.jpg "Immunocytochemistry/Immunofluorescence: PCGF6 Antibody (2B8) [H00084108-M01] - Analysis of monoclonal antibody to PCGF6 on HeLa cell . Antibody concentration 10 ug/ml.")
| Reactivity | HuSpecies Glossary |
| Applications | ELISA, ICC/IF |
| Clone | 2B8 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | PCGF6 (NP_001011663, 225 a.a. ~ 324 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AVPQPVPSSKGRSKKVLESVFRIPPELDMSLLLEFIGANEGTGHFKPLEKKFVRVSGEATIGHVEKFLRRKMGLDPACQVDIICGDHLLEQYQTLREIRR |
| Specificity | PCGF6 - polycomb group ring finger 6 (2B8) |
| Isotype | IgG2b Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | PCGF6 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | This product is useful for ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for PCGF6 Antibody (H00084108-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PCGF6 |
| Entrez |
|
| Uniprot |
|
![Sandwich ELISA: PCGF6 Antibody (2B8) [H00084108-M01] - Detection limit for recombinant GST tagged PCGF6 is 1 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/PCGF6-Antibody-2B8-Sandwich-ELISA-H00084108-M01-img0003.jpg "Sandwich ELISA: PCGF6 Antibody (2B8) [H00084108-M01] - Detection limit for recombinant GST tagged PCGF6 is 1 ng/ml as a capture antibody.")
![Bioactivity IL-4 [Unconjugated]](https://images.novusbio.com/images/protein/6507-ilcf_recombinant-human-il-4-cho-expressed-protein-cf-bioactivity-272020133214.jpg)
