![Immunocytochemistry/Immunofluorescence: Cbx2 Antibody [NBP2-47524] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Cbx2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-47524-img0004.jpg "Immunocytochemistry/Immunofluorescence: Cbx2 Antibody [NBP2-47524] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KRDCVKGSATPSGQESRTAPGEARKAATLPEMSAGEESSSSDSDPDSASPPSTGQNPSVSVQTSQDWKPTRSLIEHVFVTDVTANLITVTVKESPTSV |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CBX2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP2-47524 | Applications | Species |
|---|---|---|
| Brubaker LW, Backos DS, Nguyen VT et al. Novel chromobox 2 inhibitory peptide decreases tumor progression Expert opinion on therapeutic targets 2023-05-27 [PMID: 37243607] (Immunohistochemistry) | Immunohistochemistry |
Secondary Antibodies |
Isotype Controls |
Research Areas for Cbx2 Antibody (NBP2-47524)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CBX2 |
![Immunohistochemistry-Paraffin: Cbx2 Antibody [NBP2-47524] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/Cbx2-Antibody-Immunohistochemistry-Paraffin-NBP2-47524-img0008.jpg "Immunohistochemistry-Paraffin: Cbx2 Antibody [NBP2-47524] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: Cbx2 Antibody [NBP2-47524] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/Cbx2-Antibody-Immunohistochemistry-Paraffin-NBP2-47524-img0005.jpg "Immunohistochemistry-Paraffin: Cbx2 Antibody [NBP2-47524] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: Cbx2 Antibody [NBP2-47524] - Staining of human placenta shows moderate nuclear positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/Cbx2-Antibody-Immunohistochemistry-Paraffin-NBP2-47524-img0006.jpg "Immunohistochemistry-Paraffin: Cbx2 Antibody [NBP2-47524] - Staining of human placenta shows moderate nuclear positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: Cbx2 Antibody [NBP2-47524] - Staining of human endometrium shows moderate nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/Cbx2-Antibody-Immunohistochemistry-Paraffin-NBP2-47524-img0007.jpg "Immunohistochemistry-Paraffin: Cbx2 Antibody [NBP2-47524] - Staining of human endometrium shows moderate nuclear positivity in glandular cells.")
![Immunohistochemistry Podocalyxin Like Antibody [Unconjugated]](https://images.novusbio.com/images2/Podocalyxin_AF1556_Immunohistochemistry_11445.jpg)
![Western Blot Podocalyxin Like Antibody [Unconjugated]](https://images.novusbio.com/images2/Podocalyxin_AF1556_Western_Blot_12581.jpg)
![Immunocytochemistry/ Immunofluorescence Podocalyxin Like Antibody [Unconjugated]](https://images.novusbio.com/images/af1556_mouse-podocalyxin-affinity-purified-polyclonal-ab-41202410485429.jpg)
![Immunocytochemistry SOX9 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOX9_AF3075_Immunocytochemistry_15995.jpg)
![Western Blot SOX9 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOX9_AF3075_Western_Blot_21580.jpg)
![Immunocytochemistry SOX9 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOX9_AF3075_Immunocytochemistry_6490.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")