![Western Blot: p16INK4a/CDKN2A Antibody (0D0C8) [NBP3-15420] - Analysis of extracts of HeLa cells, using p16INK4a/CDKN2A Rabbit mAb (NBP3-15420) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.](http://images.novusbio.com/fullsize/p16INK4a-CDKN2A-Antibody-0D0C8-Western-Blot-NBP3-15420-img0004.jpg "Western Blot: p16INK4a/CDKN2A Antibody (0D0C8) [NBP3-15420] - Analysis of extracts of HeLa cells, using p16INK4a/CDKN2A Rabbit mAb (NBP3-15420) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC, KO |
| Clone | 0D0C8 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 57-156 of human p16INK4a/CDKN2A (P42771). ARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | CDKN2A |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 16 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Western Blot PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Western_Blot_11082.jpg)
![Immunohistochemistry PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Immunohistochemistry_11144.jpg)
![Immunohistochemistry PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Immunohistochemistry_11480.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for p16INK4a/CDKN2A Antibody (NBP3-15420)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CDKN2A |
![Immunocytochemistry/Immunofluorescence: p16INK4a/CDKN2A Antibody (0D0C8) [NBP3-15420] - Immunofluorescence analysis of HeLa cells using p16INK4a/CDKN2A Rabbit mAb (NBP3-15420) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/p16INK4a-CDKN2A-Antibody-0D0C8-Immunocytochemistry-Immunofluorescence-NBP3-15420-img0003.jpg "Immunocytochemistry/Immunofluorescence: p16INK4a/CDKN2A Antibody (0D0C8) [NBP3-15420] - Immunofluorescence analysis of HeLa cells using p16INK4a/CDKN2A Rabbit mAb (NBP3-15420) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunohistochemistry-Paraffin: p16INK4a/CDKN2A Antibody (0D0C8) [NBP3-15420] - Human cervix cancer using [KO Validated] p16INK4a/CDKN2A Rabbit mAb (NBP3-15420) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/p16INK4a-CDKN2A-Antibody-0D0C8-Immunohistochemistry-Paraffin-NBP3-15420-img0002.jpg "Immunohistochemistry-Paraffin: p16INK4a/CDKN2A Antibody (0D0C8) [NBP3-15420] - Human cervix cancer using [KO Validated] p16INK4a/CDKN2A Rabbit mAb (NBP3-15420) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.")
![Knockout Validated: p16INK4a/CDKN2A Antibody (0D0C8) [NBP3-15420] - Analysis of extracts from normal (control) and p16INK4a/CDKN2A knockout (KO) 293T cells, using p16INK4a/CDKN2A Rabbit mAb (NBP3-15420) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.](http://images.novusbio.com/fullsize/p16INK4a-CDKN2A-Antibody-0D0C8-Knockout-Validated-NBP3-15420-img0001.jpg "Knockout Validated: p16INK4a/CDKN2A Antibody (0D0C8) [NBP3-15420] - Analysis of extracts from normal (control) and p16INK4a/CDKN2A knockout (KO) 293T cells, using p16INK4a/CDKN2A Rabbit mAb (NBP3-15420) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.")
![Western Blot RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Western_Blot_10216.jpg)
![Immunocytochemistry RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Immunocytochemistry_10464.jpg)
![Simple Western RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Simple_Western_16629.jpg)
![Western Blot p27/Kip1 [p Thr157] Antibody](https://images.novusbio.com/images2/p27_AF1555_Western_Blot_5119.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")