![Western Blot: OVOL1 Antibody [H00005017-B02P] - Analysis of OVOL1 expression in transfected 293T cell line by OVOL1 polyclonal antibody. Lane 1: OVOL1 transfected lysate(29.37 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/OVOL1-Antibody-Western-Blot-H00005017-B02P-img0002.jpg "Western Blot: OVOL1 Antibody [H00005017-B02P] - Analysis of OVOL1 expression in transfected 293T cell line by OVOL1 polyclonal antibody. Lane 1: OVOL1 transfected lysate(29.37 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody reactive against mammalian transfected lysate. |
| Immunogen | OVOL1 (NP_004552.2, 1 a.a. - 267 a.a.) full-length human protein. MPRAFLVKKPCVSTCKRNWSELPDEERGEIYVPVSLGFCPPQPYREPEPSVAEPPSCPLALNMSLRDSSYSMAPGPCVVAQLPSEDMGHLTDPQSRDHGFLRTKMKVTLGDSPSGDLFTCRVCQKAFTYQRMLNRHMKCHNDVKRHLCTYCGKGFNDTFDLKRHVRTHTGVRPYKCSLCDKAFTQRCSLESHLKKIHGVQQKYAYKERRAKLYVCEECGCTSESQEGHVLHLKEHHPDSPLLRKTSKKVAVALQNTVTSLLQGSPHL |
| Specificity | OVOL1 - ovo-like 1(Drosophila), |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | OVOL1 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | OVOL1 |
| Entrez |
|
| Uniprot |
|
![Western Blot Neurogenin-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neurogenin-3_AF3444_Western_Blot_5300.jpg)
![Immunohistochemistry Neurogenin-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/af3444_human-neurogenin-3-affinity-purified-polyclonal-ab-immunohistochemistry-192021141921.jpg)
![Western Blot Smad2/3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad3_AF3797_Western_Blot_5347.jpg)
![Chromatin Immunoprecipitation (ChIP) Smad2/3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad3_AF3797_Chromatin_Immunoprecipitation_11240.jpg)
![Immunocytochemistry Smad2/3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad3_AF3797_Immunocytochemistry_11829.jpg)
![Chromatin Immunoprecipitation (ChIP) Smad4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad4_AF2097_Chromatin_Immunoprecipitation_11225.jpg)
![Western Blot Smad4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad4_AF2097_Western_Blot_17168.jpg)
![Immunocytochemistry Smad4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad4_AF2097_Immunocytochemistry__Immunofluorescence_17807.jpg)
![Bioactivity TGF-beta 1 [Unconjugated]](https://images.novusbio.com/images/protein/7754-bhcf_recombinant-human-tgf-beta-1-human-cell-expressed-cf-bioactivity-1811202013946.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")