![Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody [NBP1-88121] - mmunohistochemical staining of human kidney shows no positivity as expected.](http://images.novusbio.com/fullsize/Ornithine-Carbamoyltransferase-Antibody-Immunohistochemistry-Paraffin-NBP1-88121-img0016.jpg "Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody [NBP1-88121] - mmunohistochemical staining of human kidney shows no positivity as expected.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QLKGRDLLTLKNFTGEEIKYMLWLSADLKFRIKQKGEYLPLLQGKSLGMIFEKRSTRTRLSTETGFALLGGHPCFLTTQDIHLGVNESLTDTARVLSSMADAVLAR |
| Predicted Species | Mouse (97%), Rat (97%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | OTC |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
| Publication using NBP1-88121 | Applications | Species |
|---|---|---|
| Montes-Nieto R, Fuentes-Almagro CA, Bonilla-Valverde D et al. Proteomics in free-living Mus spretus to monitor terrestrial ecosystems. Proteomics 2007-12-01 [PMID: 17973291] |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | OTC |
![Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody [NBP1-88121] - Staining of human kidney shows low expression as expected.](http://images.novusbio.com/fullsize/Ornithine-Carbamoyltransferase-Antibody-Immunohistochemistry-Paraffin-NBP1-88121-img0004.jpg "Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody [NBP1-88121] - Staining of human kidney shows low expression as expected.")
![Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody [NBP1-88121] - Staining of human liver shows high expression.](http://images.novusbio.com/fullsize/Ornithine-Carbamoyltransferase-Antibody-Immunohistochemistry-Paraffin-NBP1-88121-img0005.jpg "Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody [NBP1-88121] - Staining of human liver shows high expression.")
![Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody [NBP1-88121] - Staining of human testis.](http://images.novusbio.com/fullsize/Ornithine-Carbamoyltransferase-Antibody-Immunohistochemistry-Paraffin-NBP1-88121-img0008.jpg "Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody [NBP1-88121] - Staining of human testis.")
![Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody [NBP1-88121] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize/Ornithine-Carbamoyltransferase-Antibody-Immunohistochemistry-Paraffin-NBP1-88121-img0009.jpg "Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody [NBP1-88121] - Staining of human cerebral cortex.")
![Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody [NBP1-88121] - Staining of human duodenum.](http://images.novusbio.com/fullsize/Ornithine-Carbamoyltransferase-Antibody-Immunohistochemistry-Paraffin-NBP1-88121-img0010.jpg "Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody [NBP1-88121] - Staining of human duodenum.")
![Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody [NBP1-88121] - Staining of human liver using Anti-OTC antibody NBP1-88121.](http://images.novusbio.com/fullsize/Ornithine-Carbamoyltransferase-Antibody-Immunohistochemistry-Paraffin-NBP1-88121-img0011.jpg "Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody [NBP1-88121] - Staining of human liver using Anti-OTC antibody NBP1-88121.")
![Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody [NBP1-88121] - Staining of human cerebral cortex, kidney, liver and small intestine using Anti-OTC antibody NBP1-88121 (A) shows similar protein distribution across tissues to independent antibody NBP1-87408 (B).](http://images.novusbio.com/fullsize/Ornithine-Carbamoyltransferase-Antibody-Immunohistochemistry-Paraffin-NBP1-88121-img0012.jpg "Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody [NBP1-88121] - Staining of human cerebral cortex, kidney, liver and small intestine using Anti-OTC antibody NBP1-88121 (A) shows similar protein distribution across tissues to independent antibody NBP1-87408 (B).")
![Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody [NBP1-88121] - Analysis in human liver and kidney tissues using NBP1-88121 antibody. Corresponding OTC RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Ornithine-Carbamoyltransferase-Antibody-Immunohistochemistry-Paraffin-NBP1-88121-img0013.jpg "Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody [NBP1-88121] - Analysis in human liver and kidney tissues using NBP1-88121 antibody. Corresponding OTC RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody [NBP1-88121] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/Ornithine-Carbamoyltransferase-Antibody-Immunohistochemistry-Paraffin-NBP1-88121-img0014.jpg "Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody [NBP1-88121] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody [NBP1-88121] - Staining of human small intestine shows moderate granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/Ornithine-Carbamoyltransferase-Antibody-Immunohistochemistry-Paraffin-NBP1-88121-img0015.jpg "Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody [NBP1-88121] - Staining of human small intestine shows moderate granular cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody [NBP1-88121] - Staining of human cerebral cortex shows no positivity in neurons as expected.](http://images.novusbio.com/fullsize/Ornithine-Carbamoyltransferase-Antibody-Immunohistochemistry-Paraffin-NBP1-88121-img0017.jpg "Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody [NBP1-88121] - Staining of human cerebral cortex shows no positivity in neurons as expected.")
![Immunohistochemistry CD55/DAF Antibody [Unconjugated]](https://images.novusbio.com/images2/CD55_AF2009_Immunohistochemistry_6728.jpg)
![Immunocytochemistry CD55/DAF Antibody [Unconjugated]](https://images.novusbio.com/images2/CD55_AF2009_Immunocytochemistry__Immunofluorescence_23052.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")