![Western Blot: Optineurin Antibody [NBP1-84682] - Analysis in human cell lines A-431 and PC-3. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.](http://images.novusbio.com/fullsize/Optineurin-Antibody-Western-Blot-NBP1-84682-img0018.jpg "Western Blot: Optineurin Antibody [NBP1-84682] - Analysis in human cell lines A-431 and PC-3. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LGIVSELQLKLNSSGSSEDSFVEIRMAEGEAEGSVKEIKHSPGPTRTVSTGTALSKYRSRSADGAKNYFEHEELTVSQLLLCLREGNQKVERLEVALKEAKERVSDFEKKTSNRSEIETQTEGSTEKENDEEKG |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | OPTN |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-Paraffin HIER pH6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry Neuropilin-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neuropilin1_AF566_Immunohistochemistry_21496.jpg)
![Immunohistochemistry Neuropilin-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neuropilin1_AF566_Immunohistochemistry_21497.jpg)
![Western Blot Neuropilin-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neuropilin1_AF566_Western_Blot_21557.jpg)
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
WB | Mouse | 02/20/2018 |
Summary
|
||||||||
-(01-ml)_NBP1-84682_9411.jpg)
Enlarge |
reviewed by:
Bryan Tinsley |
IHC-Fr | Mouse | 08/16/2014 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for Optineurin Antibody (NBP1-84682)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Verified Customer 02/20/2018 |
||
| Application: | WB | |
| Species: | Mouse |
| Bryan Tinsley 08/16/2014 |
||
| Application: | IHC-Fr | |
| Species: | Mouse |
| Gene Symbol | OPTN |
![Western Blot: Optineurin Antibody [NBP1-84682] - Analysis using Anti-OPTN antibody NBP1-84682 (A) shows similar pattern to independent antibody NBP1-84683 (B).](http://images.novusbio.com/fullsize/Optineurin-Antibody-Western-Blot-NBP1-84682-img0023.jpg "Western Blot: Optineurin Antibody [NBP1-84682] - Analysis using Anti-OPTN antibody NBP1-84682 (A) shows similar pattern to independent antibody NBP1-84683 (B).")
![Immunocytochemistry/Immunofluorescence: Optineurin Antibody [NBP1-84682] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining shown in green.](http://images.novusbio.com/fullsize/Optineurin-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84682-img0012.jpg "Immunocytochemistry/Immunofluorescence: Optineurin Antibody [NBP1-84682] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining shown in green.")
![Immunohistochemistry-Paraffin: Optineurin Antibody [NBP1-84682] - Staining of human pancreas shows no cytoplasmic positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/Optineurin-Antibody-Immunohistochemistry-Paraffin-NBP1-84682-img0016.jpg "Immunohistochemistry-Paraffin: Optineurin Antibody [NBP1-84682] - Staining of human pancreas shows no cytoplasmic positivity in exocrine glandular cells as expected.")
![Western Blot: Optineurin Antibody [NBP1-84682] - Effect of mitochondrial fission protein, Drp1 (FL) and mutant Tau on Optineurin expression in N2a (M) cells. Lanes: M. Ladder M. Ladder 1. N2a cells 2. N2a cells + mutant Tau 3. N2a cells + mutant tau + Drp1 full length + mutant Tau. This image was submitted via customer review.](http://images.novusbio.com/fullsize/Optineurin-Antibody-Western-Blot-NBP1-84682-img0022.jpg "Western Blot: Optineurin Antibody [NBP1-84682] - Effect of mitochondrial fission protein, Drp1 (FL) and mutant Tau on Optineurin expression in N2a (M) cells. Lanes: M. Ladder M. Ladder 1. N2a cells 2. N2a cells + mutant Tau 3. N2a cells + mutant tau + Drp1 full length + mutant Tau. This image was submitted via customer review.")
![Immunohistochemistry-Frozen: Optineurin Antibody [NBP1-84682] - Image and review of Optineurin antibody on mouse retina (frozen sections) by Celia McKee, Duke University. 20X and 100X.](http://images.novusbio.com/fullsize/Optineurin-Antibody-Immunohistochemistry-Frozen-NBP1-84682-img0006.jpg "Immunohistochemistry-Frozen: Optineurin Antibody [NBP1-84682] - Image and review of Optineurin antibody on mouse retina (frozen sections) by Celia McKee, Duke University. 20X and 100X.")
![Immunohistochemistry-Paraffin: Optineurin Antibody [NBP1-84682] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.](http://images.novusbio.com/fullsize/Optineurin-Antibody-Immunohistochemistry-Paraffin-NBP1-84682-img0013.jpg "Immunohistochemistry-Paraffin: Optineurin Antibody [NBP1-84682] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.")
![Immunohistochemistry-Paraffin: Optineurin Antibody [NBP1-84682] - Staining of human skin shows moderate cytoplasmic positivity in epidermal cells.](http://images.novusbio.com/fullsize/Optineurin-Antibody-Immunohistochemistry-Paraffin-NBP1-84682-img0014.jpg "Immunohistochemistry-Paraffin: Optineurin Antibody [NBP1-84682] - Staining of human skin shows moderate cytoplasmic positivity in epidermal cells.")
![Immunohistochemistry-Paraffin: Optineurin Antibody [NBP1-84682] - Staining of human placenta shows moderate to strong cytoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/Optineurin-Antibody-Immunohistochemistry-Paraffin-NBP1-84682-img0015.jpg "Immunohistochemistry-Paraffin: Optineurin Antibody [NBP1-84682] - Staining of human placenta shows moderate to strong cytoplasmic positivity in trophoblastic cells.")
![Immunohistochemistry Myocilin Antibody (297817) [Unconjugated]](https://images.novusbio.com/images/antibody/mab3446_human-myocilin-mab-clone-297817-immunohistochemistry-222023115227.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![Immunohistochemistry Neuropilin-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neuropilin2_AF567_Immunohistochemistry_16084.jpg)
![Western Blot Neuropilin-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neuropilin2_AF567_Western_Blot_20048.jpg)
![Simple Western Neuropilin-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neuropilin2_AF567_Simple_Western_20049.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot ALS Antibody [Unconjugated]](https://images.novusbio.com/images2/ALS_AF1436_Western_Blot_17079.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
-(01-ml)_NBP1-84682_9411.jpg)