![Western Blot: MYO6 Antibody (2E12) [H00004646-M02] - MYO6 monoclonal antibody (M02), clone 2E12. Analysis of MYO6 expression in MCF-7.](http://images.novusbio.com/fullsize/MYO6-Antibody-2E12-Western-Blot-H00004646-M02-img0002.jpg "Western Blot: MYO6 Antibody (2E12) [H00004646-M02] - MYO6 monoclonal antibody (M02), clone 2E12. Analysis of MYO6 expression in MCF-7.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ELISA, IHC |
| Clone | 2E12 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | MYO6 (NP_004990.2, 1188 a.a. ~ 1285 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KKKGWWYAHFDGPWIARQMELHPDKPPILLVAGKDDMEMCELNLEETGLTRKRGAEILPRQFEEIWERCGGIQYLQNAIESRQARPTYATAMLQSLLK |
| Specificity | This product is specific for Human MYO6 monoclonal antibody (M02), clone 2E12 [Gene ID: 4646]. |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | MYO6 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Use in Immunohistochemistry reported in scientific literature (PMID:34335185). |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Immunohistochemistry Neuropilin-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neuropilin1_AF566_Immunohistochemistry_21496.jpg)
![Immunohistochemistry Neuropilin-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neuropilin1_AF566_Immunohistochemistry_21497.jpg)
![Western Blot Neuropilin-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neuropilin1_AF566_Western_Blot_21557.jpg)
| Publication using H00004646-M02 | Applications | Species |
|---|---|---|
| Stalmann U, Franke Aj, Al-Moyed H Et Al. Otoferlin Is Required for Proper Synapse Maturation and for Maintenance of Inner and Outer Hair Cells in Mouse Models for DFNB9 Frontiers in Cellular Neuroscience 2021-07-14 [PMID: 34335185] (IF/IHC) | IF/IHC |
Secondary Antibodies |
Isotype Controls |
Research Areas for MYO6 Antibody (H00004646-M02)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MYO6 |
| Uniprot |
|
![Sandwich ELISA: MYO6 Antibody (2E12) [H00004646-M02] - Detection limit for recombinant GST tagged MYO6 is 0.3 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/MYO6-Antibody-2E12-Sandwich-ELISA-H00004646-M02-img0001.jpg "Sandwich ELISA: MYO6 Antibody (2E12) [H00004646-M02] - Detection limit for recombinant GST tagged MYO6 is 0.3 ng/ml as a capture antibody.")
![Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunohistochemistry_22971.jpg)
![Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunohistochemistry_22972.jpg)
![Immunocytochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunocytochemistry_9890.jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_6973.jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_9671.jpg)
![Immunoprecipitation CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images/mab25031_human-cftr-c-terminus-mab-clone-24-1-41202412513815.jpg)
