![Western Blot: NUSAP1 Antibody [H00051203-B01P] - Depletion of NUSAP1 induces DNA damage in GBM cells. The level of the indicated proteins in GBM cells with NUSAP1 knockdown for 0h, 24h, 48h, 72h, and 96h. All data are used as the mean+/- SD, and significant differences were determined by Student's t test. *P<0.05, **P<0.01, ***P<0.001. P<0.05 was considered statistically significant. Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41392-020-0137-7), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/NUSAP1-Antibody-Western-Blot-H00051203-B01P-img0008.jpg "Western Blot: NUSAP1 Antibody [H00051203-B01P] - Depletion of NUSAP1 induces DNA damage in GBM cells. The level of the indicated proteins in GBM cells with NUSAP1 knockdown for 0h, 24h, 48h, 72h, and 96h. All data are used as the mean+/- SD, and significant differences were determined by Student's t test. *P<0.05, **P<0.01, ***P<0.001. P<0.05 was considered statistically significant. Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41392-020-0137-7), licensed under a CC-BY license.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | NUSAP1 (NP_057443.1, 1 a.a. - 226 a.a.) full-length human protein. MNELKQQPINKGGVRTPVPPRGRLSVASTPISQRRSQGRSCGPASQSTLGLKGSLKRSAISAAKTGVRFSAATKDNEHKRSLTKTPARKSAHVTVSGGTPKGEAVLGTHKLKTITGNSAAVITPFKLTTEATQTPVSNKKPVFDLKASLSRPLNYEPHKGKLKPWGQSKENNYLNQHVNRINFYKKTYKQPHLQTKEEQRKKREQERKEKKAKVLGMRRGLILAED |
| Specificity | NUSAP1 - nucleolar and spindle associated protein 1, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | NUSAP1 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
| Publication using H00051203-B01P | Applications | Species |
|---|---|---|
| NUSAP1 Potentiates Chemoresistance in Glioblastoma Through Its SAP Domain to Stabilize ATR Zhao Y, He J, Li Y et al. Signal Transduct Target Ther. [PMID: 32317623] (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for NUSAP1 Antibody (H00051203-B01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NUSAP1 |
| Entrez |
|
| Uniprot |
|
![Western Blot: NUSAP1 Antibody [H00051203-B01P] - Depletion of NUSAP1 induces DNA damage in GBM cells. Western blot analyses of DDR proteins in GBM with NUSAP1 knockdown. Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41392-020-0137-7), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/NUSAP1-Antibody-Western-Blot-H00051203-B01P-img0007.jpg "Western Blot: NUSAP1 Antibody [H00051203-B01P] - Depletion of NUSAP1 induces DNA damage in GBM cells. Western blot analyses of DDR proteins in GBM with NUSAP1 knockdown. Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41392-020-0137-7), licensed under a CC-BY license.")
![Western Blot: NUSAP1 Antibody [H00051203-B01P] - Silencing NUSAP1 inhibits cell proliferation and causes apoptosis in GBM cells. a Western blot analyses of NUSAP1 in cells with NUSAP1 knockdown. Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41392-020-0137-7), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/NUSAP1-Antibody-Western-Blot-H00051203-B01P-img0009.jpg "Western Blot: NUSAP1 Antibody [H00051203-B01P] - Silencing NUSAP1 inhibits cell proliferation and causes apoptosis in GBM cells. a Western blot analyses of NUSAP1 in cells with NUSAP1 knockdown. Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41392-020-0137-7), licensed under a CC-BY license.")
![Immunocytochemistry/Immunofluorescence: NUSAP1 Antibody [H00051203-B01P] - Analysis of purified antibody to NUSAP1 on HeLa cell. (antibody concentration 10 ug/ml)](http://images.novusbio.com/fullsize/NUSAP1-Antibody-Immunocytochemistry-Immunofluorescence-H00051203-B01P-img0003.jpg "Immunocytochemistry/Immunofluorescence: NUSAP1 Antibody [H00051203-B01P] - Analysis of purified antibody to NUSAP1 on HeLa cell. (antibody concentration 10 ug/ml)")
![Western Blot: NUSAP1 Antibody [H00051203-B01P] - Analysis of NUSAP1 expression in transfected 293T cell line by NUSAP1 polyclonal antibody. Lane 1: NUSAP1 transfected lysate(24.86 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/NUSAP1-Antibody-Western-Blot-H00051203-B01P-img0004.jpg "Western Blot: NUSAP1 Antibody [H00051203-B01P] - Analysis of NUSAP1 expression in transfected 293T cell line by NUSAP1 polyclonal antibody. Lane 1: NUSAP1 transfected lysate(24.86 KDa). Lane 2: Non-transfected lysate.")
![Western Blot: NUSAP1 Antibody [H00051203-B01P] - Depletion of NUSAP1 induces DNA damage in GBM cells. a Mini ontology obtained in French’s database using gene sets related to NUSAP1, which were identified by a significant difference of P < 0.001. b Tailed DNA in single cells depleted of NUSAP1. c IF staining of gamma -H2AX in NUSAP1-knockdown GBM cells. d Quantification of gamma -H2AX foci in the indicated GBM cells. e Western blot analyses of DDR proteins in GBM with NUSAP1 knockdown. f The level of the indicated proteins in GBM cells with NUSAP1 knockdown for 0 h, 24 h, 48 h, 72 h, & 96 h. All data are used as the mean ± SD, & significant differences were determined by Student’s t test. *P < 0.05, **P < 0.01, ***P < 0.001. P < 0.05 was considered statistically significant Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/32317623), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/h00051203-b01p_mouse-polyclonal-nusap1-antibody-310202415371981.jpg "Western Blot: NUSAP1 Antibody [H00051203-B01P] - Depletion of NUSAP1 induces DNA damage in GBM cells. a Mini ontology obtained in French’s database using gene sets related to NUSAP1, which were identified by a significant difference of P < 0.001. b Tailed DNA in single cells depleted of NUSAP1. c IF staining of gamma -H2AX in NUSAP1-knockdown GBM cells. d Quantification of gamma -H2AX foci in the indicated GBM cells. e Western blot analyses of DDR proteins in GBM with NUSAP1 knockdown. f The level of the indicated proteins in GBM cells with NUSAP1 knockdown for 0 h, 24 h, 48 h, 72 h, & 96 h. All data are used as the mean ± SD, & significant differences were determined by Student’s t test. *P < 0.05, **P < 0.01, ***P < 0.001. P < 0.05 was considered statistically significant Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/32317623), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: NUSAP1 Antibody [H00051203-B01P] - Silencing NUSAP1 inhibits cell proliferation & causes apoptosis in GBM cells. a Western blot analyses of NUSAP1 in cells with NUSAP1 knockdown. b The morphology & cell number of GBM cells after knocking down NUSAP1. c Viability of NUSAP1-knockdown GBM cells. d BrdU-positive GBM cells after knocking down NUSAP1. e Flow cytometry analyses of apoptosis in GBM cells with NUSAP1 knockdown. f The expression of the apoptotic proteins bcl2 & cleaved caspase-3 in cells with NUSAP1 knockdown. g Caspase-3/7 activity of GBM cells with NUSAP1 knockdown. All data are expressed as the mean ± SD, & significant differences were determined by Student’s t test. *P < 0.05, **P < 0.01, ***P < 0.001. P < 0.05 was considered statistically significant Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/32317623), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/h00051203-b01p_mouse-polyclonal-nusap1-antibody-310202415171312.jpg "Western Blot: NUSAP1 Antibody [H00051203-B01P] - Silencing NUSAP1 inhibits cell proliferation & causes apoptosis in GBM cells. a Western blot analyses of NUSAP1 in cells with NUSAP1 knockdown. b The morphology & cell number of GBM cells after knocking down NUSAP1. c Viability of NUSAP1-knockdown GBM cells. d BrdU-positive GBM cells after knocking down NUSAP1. e Flow cytometry analyses of apoptosis in GBM cells with NUSAP1 knockdown. f The expression of the apoptotic proteins bcl2 & cleaved caspase-3 in cells with NUSAP1 knockdown. g Caspase-3/7 activity of GBM cells with NUSAP1 knockdown. All data are expressed as the mean ± SD, & significant differences were determined by Student’s t test. *P < 0.05, **P < 0.01, ***P < 0.001. P < 0.05 was considered statistically significant Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/32317623), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: NUSAP1 Antibody [H00051203-B01P] - Depletion of NUSAP1 induces DNA damage in GBM cells. a Mini ontology obtained in French’s database using gene sets related to NUSAP1, which were identified by a significant difference of P < 0.001. b Tailed DNA in single cells depleted of NUSAP1. c IF staining of gamma -H2AX in NUSAP1-knockdown GBM cells. d Quantification of gamma -H2AX foci in the indicated GBM cells. e Western blot analyses of DDR proteins in GBM with NUSAP1 knockdown. f The level of the indicated proteins in GBM cells with NUSAP1 knockdown for 0 h, 24 h, 48 h, 72 h, & 96 h. All data are used as the mean ± SD, & significant differences were determined by Student’s t test. *P < 0.05, **P < 0.01, ***P < 0.001. P < 0.05 was considered statistically significant Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/32317623), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/h00051203-b01p_mouse-polyclonal-nusap1-antibody-3102024153431.jpg "Western Blot: NUSAP1 Antibody [H00051203-B01P] - Depletion of NUSAP1 induces DNA damage in GBM cells. a Mini ontology obtained in French’s database using gene sets related to NUSAP1, which were identified by a significant difference of P < 0.001. b Tailed DNA in single cells depleted of NUSAP1. c IF staining of gamma -H2AX in NUSAP1-knockdown GBM cells. d Quantification of gamma -H2AX foci in the indicated GBM cells. e Western blot analyses of DDR proteins in GBM with NUSAP1 knockdown. f The level of the indicated proteins in GBM cells with NUSAP1 knockdown for 0 h, 24 h, 48 h, 72 h, & 96 h. All data are used as the mean ± SD, & significant differences were determined by Student’s t test. *P < 0.05, **P < 0.01, ***P < 0.001. P < 0.05 was considered statistically significant Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/32317623), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunohistochemistry LDLR Antibody [Unconjugated]](https://images.novusbio.com/images2/LDL_R_AF2255_Immunohistochemistry_7149.jpg)
![Western Blot LDLR Antibody [Unconjugated]](https://images.novusbio.com/images2/LDLR_AF2255_Western_Blot_23731.jpg)
![Western Blot LDLR Antibody [Unconjugated]](https://images.novusbio.com/images/af2255_mouse-ldl-r-affinity-purified-polyclonal-ab-4120241049445.jpg)
![SDS-PAGE BMP-4 [Unconjugated]](https://images.novusbio.com/images2/BMP-4_314-BP_100.jpg)
![Bioactivity BMP-4 [Unconjugated]](https://images.novusbio.com/images2/314-bp_recombinant-human-bmp-4-protein-1882021123744.jpg)
![N/A TNF RI/TNFRSF1A [HRP]](https://images.novusbio.com/images2/DATA_TNF_RI_DRT100_ELISA_815.jpg)
![N/A TNF RI/TNFRSF1A [HRP]](https://images.novusbio.com/images2/DATA_TNF_RI_DRT100_ELISA_816.jpg)
![N/A TNF RI/TNFRSF1A [HRP]](https://images.novusbio.com/images2/TNF_RI_DRT100_ELISA_175.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")