![Western Blot: NuMA Antibody [NBP2-54672] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.](http://images.novusbio.com/fullsize/NuMA-Antibody-Western-Blot-NBP2-54672-img0005.jpg "Western Blot: NuMA Antibody [NBP2-54672] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a Recombinant Protein corresponding to amino acids: IRFLELQKVASSSSGNNFLSGSPASPMGDILQTPQFQMRRLKKQLADERSNRDELELELAENRKLLTEKDAQIAMMQQRIDRLALLNEKQAASPLEPKEL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NUMA1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot STAT5b Antibody [Unconjugated]](https://images.novusbio.com/images2/STAT5b_AF1584_Western_Blot_5126.jpg)
![Simple Western STAT5b Antibody [Unconjugated]](https://images.novusbio.com/images2/16321.jpg)
![Knockout Validated STAT5b Antibody [Unconjugated]](https://images.novusbio.com/images2/STAT5b_AF1584_Knockout_Validated_21968.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for NuMA Antibody (NBP2-54672)Find related products by research area.
|
|
NuMA: The Key to Asymmetric Cell Division Nuclear Mitotic Apparatus protein (NuMA) is a cell cycle-related protein that acts as an organizer of the mitotic spindle during mitosis. It may be involved in coordinating the alignment of the mitotic spindle to the cellular polarity axis, which is a... Read full blog post. |
|
Nucleus and Mitotic Apparatus (NuMA) Protein in Cell Cycle Regulation NuMA, the major protein of the "Nucleus and Mitotic Apparatus", is a structural protein in vertebrates involved in cell cycle regulation. It localizes to the nucleus during interphase, and accumulates at the spindle poles during mitosis and NuMA has b... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NUMA1 |
![Immunohistochemistry-Paraffin: NuMA Antibody [NBP2-54672] -Staining of human fallopian tube, gastrointestinal, kidney and lymphoid tissues using Anti-NUMA1 antibody NBP2-54672 (A) shows similar protein distribution across tissues to independent antibody.](http://images.novusbio.com/fullsize/antibody/nbp2-54672_rabbit-polyclonal-numa-antibody-immunohistochemistry-paraffin-108202395858..jpg "Immunohistochemistry-Paraffin: NuMA Antibody [NBP2-54672] -Staining of human fallopian tube, gastrointestinal, kidney and lymphoid tissues using Anti-NUMA1 antibody NBP2-54672 (A) shows similar protein distribution across tissues to independent antibody.")
![Immunocytochemistry/Immunofluorescence: NuMA Antibody [NBP2-54672] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.](http://images.novusbio.com/fullsize/NuMA-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-54672-img0003.jpg "Immunocytochemistry/Immunofluorescence: NuMA Antibody [NBP2-54672] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.")
![Immunohistochemistry-Paraffin: NuMA Antibody [NBP2-54672] -Staining of human fallopian tube shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/antibody/nbp2-54672_rabbit-polyclonal-numa-antibody-immunohistochemistry-paraffin-108202310024..jpg "Immunohistochemistry-Paraffin: NuMA Antibody [NBP2-54672] -Staining of human fallopian tube shows strong nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: NuMA Antibody [NBP2-54672] -Staining of human rectum shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/antibody/nbp2-54672_rabbit-polyclonal-numa-antibody-immunohistochemistry-paraffin-108202310540..jpg "Immunohistochemistry-Paraffin: NuMA Antibody [NBP2-54672] -Staining of human rectum shows strong nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: NuMA Antibody [NBP2-54672] -Staining of human tonsil shows strong nuclear positivity in non-germinal center cells and germinal center cells.](http://images.novusbio.com/fullsize/antibody/nbp2-54672_rabbit-polyclonal-numa-antibody-immunohistochemistry-paraffin-10820231078..jpg "Immunohistochemistry-Paraffin: NuMA Antibody [NBP2-54672] -Staining of human tonsil shows strong nuclear positivity in non-germinal center cells and germinal center cells.")
![Immunohistochemistry-Paraffin: NuMA Antibody [NBP2-54672] -Staining of human kidney shows strong nuclear positivity in cells in tubules and cells in glomeruli.](http://images.novusbio.com/fullsize/antibody/nbp2-54672_rabbit-polyclonal-numa-antibody-immunohistochemistry-paraffin-108202310820..jpg "Immunohistochemistry-Paraffin: NuMA Antibody [NBP2-54672] -Staining of human kidney shows strong nuclear positivity in cells in tubules and cells in glomeruli.")
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_6532.jpg)
![Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase3_AF835_Immunohistochemistry_22976.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_9340.jpg)
![Western Blot PLZF Antibody [Unconjugated]](https://images.novusbio.com/images2/PLZF_AF2944_Western_Blot_5229.jpg)
![Simple Western PLZF Antibody [Unconjugated]](https://images.novusbio.com/images2/PLZF_AF2944_Simple_Western_16989.jpg)
![Western Blot PLZF Antibody [Unconjugated]](https://images.novusbio.com/images/af2944_human-plzf-affinity-purified-polyclonal-ab-41202412394950.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")