![Immunocytochemistry/ Immunofluorescence: GAS41 Antibody [NBP3-38243] - Immunofluorescence analysis of A-549 cells using GAS41 Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-38243_rabbit-gas41-pab-101220241233892.jpg "Immunocytochemistry/ Immunofluorescence: GAS41 Antibody [NBP3-38243] - Immunofluorescence analysis of A-549 cells using GAS41 Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-227 of human GAS41 (NP_006521.1). Sequence: MFKRMAEFGPDSGGRVKGVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNEDMSAYVKKIQFKLHESYGNPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYHLLKLFQSDTNAMLGKKTVVSEFYDEMIFQDPTAMMQQLLTTSRQLTLGAYKHETEFAELEVKTREKLEAAKKKTSFEIAELKERLKASRETINCLKNEIRKLEEDDQAKDI |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | YEATS4 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 26 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for GAS41 Antibody (NBP3-38243)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | YEATS4 |
![Immunohistochemistry: GAS41 Antibody [NBP3-38243] - Immunohistochemistry analysis of paraffin-embedded Rat lung using GAS41 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-38243_rabbit-gas41-pab-101220241224184.jpg "Immunohistochemistry: GAS41 Antibody [NBP3-38243] - Immunohistochemistry analysis of paraffin-embedded Rat lung using GAS41 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
![Western Blot: GAS41 Antibody [NBP3-38243] - Western blot analysis of lysates from 293T cells, using GAS41 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 180s.](http://images.novusbio.com/fullsize/nbp3-38243_rabbit-gas41-pab-1012202411592883.jpg "Western Blot: GAS41 Antibody [NBP3-38243] - Western blot analysis of lysates from 293T cells, using GAS41 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 180s.")
![Immunohistochemistry: GAS41 Antibody [NBP3-38243] - Immunohistochemistry analysis of paraffin-embedded Mouse lung using GAS41 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-38243_rabbit-gas41-pab-1012202411531076.jpg "Immunohistochemistry: GAS41 Antibody [NBP3-38243] - Immunohistochemistry analysis of paraffin-embedded Mouse lung using GAS41 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
![Immunocytochemistry/ Immunofluorescence: GAS41 Antibody [NBP3-38243] - Immunofluorescence analysis of HeLa cells using GAS41 Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-38243_rabbit-gas41-pab-1012202411552825.jpg "Immunocytochemistry/ Immunofluorescence: GAS41 Antibody [NBP3-38243] - Immunofluorescence analysis of HeLa cells using GAS41 Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Immunohistochemistry: GAS41 Antibody [NBP3-38243] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using GAS41 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-38243_rabbit-gas41-pab-1012202412063.jpg "Immunohistochemistry: GAS41 Antibody [NBP3-38243] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using GAS41 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
![Immunocytochemistry/ Immunofluorescence: GAS41 Antibody [NBP3-38243] - Immunofluorescence analysis of U2OS cells using GAS41 Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-38243_rabbit-gas41-pab-1012202411545525.jpg "Immunocytochemistry/ Immunofluorescence: GAS41 Antibody [NBP3-38243] - Immunofluorescence analysis of U2OS cells using GAS41 Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Simple Western HMGA2 Antibody [Unconjugated]](https://images.novusbio.com/images2/HMGA2_AF3184_Simple_Western_16679.jpg)
![Western Blot HMGA2 Antibody [Unconjugated]](https://images.novusbio.com/images2/HMGA2_AF3184_Western_Blot_7403.jpg)
![Immunocytochemistry HMGA2 Antibody [Unconjugated]](https://images.novusbio.com/images2/af3184_human-mouse-hmga2-affinity-purified-polyclonal-ab-immunocytochemistry-4122020143513.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")