![Western Blot: NuMA Antibody (6D4I4) [NBP3-16411] - Western blot analysis of extracts of various cell lines, using NuMA1 Rabbit mAb (NBP3-16411) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.](http://images.novusbio.com/fullsize/NuMA-Antibody-6D4I4-Western-Blot-NBP3-16411-img0004.jpg "Western Blot: NuMA Antibody (6D4I4) [NBP3-16411] - Western blot analysis of extracts of various cell lines, using NuMA1 Rabbit mAb (NBP3-16411) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clone | 6D4I4 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 2000-2100 of human NuMA1 (Q14980). TPESKKATSCFPRPMTPRDRHEGRKQSTTEAQKKAAPASTKQADRRQSMAFSILNTPKKLGNSLLRRGASKKALSKASPNTRSGTRRSPRIATTTASAATA |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | NUMA1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Simple Western STAT5b Antibody [Unconjugated]](https://images.novusbio.com/images2/16321.jpg)
![Knockout Validated STAT5b Antibody [Unconjugated]](https://images.novusbio.com/images2/STAT5b_AF1584_Knockout_Validated_21968.jpg)
![Immunocytochemistry STAT5b Antibody [Unconjugated]](https://images.novusbio.com/images2/STAT5b_AF1584_Immunocytochemistry__Immunofluorescence_17603.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for NuMA Antibody (NBP3-16411)Find related products by research area.
|
|
NuMA: The Key to Asymmetric Cell Division Nuclear Mitotic Apparatus protein (NuMA) is a cell cycle-related protein that acts as an organizer of the mitotic spindle during mitosis. It may be involved in coordinating the alignment of the mitotic spindle to the cellular polarity axis, which is a... Read full blog post. |
|
Nucleus and Mitotic Apparatus (NuMA) Protein in Cell Cycle Regulation NuMA, the major protein of the "Nucleus and Mitotic Apparatus", is a structural protein in vertebrates involved in cell cycle regulation. It localizes to the nucleus during interphase, and accumulates at the spindle poles during mitosis and NuMA has b... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NUMA1 |
![Immunohistochemistry-Paraffin: NuMA Antibody (6D4I4) [NBP3-16411] - Immunohistochemistry of paraffin-embedded mouse brain using NuMA1 Rabbit mAb (NBP3-16411) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/NuMA-Antibody-6D4I4-Immunohistochemistry-Paraffin-NBP3-16411-img0003.jpg "Immunohistochemistry-Paraffin: NuMA Antibody (6D4I4) [NBP3-16411] - Immunohistochemistry of paraffin-embedded mouse brain using NuMA1 Rabbit mAb (NBP3-16411) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: NuMA Antibody (6D4I4) [NBP3-16411] - Immunohistochemistry of paraffin-embedded rat brain using NuMA1 Rabbit mAb (NBP3-16411) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/NuMA-Antibody-6D4I4-Immunohistochemistry-Paraffin-NBP3-16411-img0001.jpg "Immunohistochemistry-Paraffin: NuMA Antibody (6D4I4) [NBP3-16411] - Immunohistochemistry of paraffin-embedded rat brain using NuMA1 Rabbit mAb (NBP3-16411) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: NuMA Antibody (6D4I4) [NBP3-16411] - Immunohistochemistry of paraffin-embedded human colon using NuMA1 Rabbit mAb (NBP3-16411) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/NuMA-Antibody-6D4I4-Immunohistochemistry-Paraffin-NBP3-16411-img0002.jpg "Immunohistochemistry-Paraffin: NuMA Antibody (6D4I4) [NBP3-16411] - Immunohistochemistry of paraffin-embedded human colon using NuMA1 Rabbit mAb (NBP3-16411) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.")
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_6532.jpg)
![Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase3_AF835_Immunohistochemistry_22976.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_9340.jpg)
![Western Blot PLZF Antibody [Unconjugated]](https://images.novusbio.com/images2/PLZF_AF2944_Western_Blot_5229.jpg)
![Simple Western PLZF Antibody [Unconjugated]](https://images.novusbio.com/images2/PLZF_AF2944_Simple_Western_16989.jpg)
![Western Blot PLZF Antibody [Unconjugated]](https://images.novusbio.com/images/af2944_human-plzf-affinity-purified-polyclonal-ab-41202412394950.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")