![Western Blot: NUAK2 Antibody [NBP1-81880] - NUAK2 activity is involved in serum-induced or LPA-induced YAP/TAZ dephosphorylation and activation. FBS and LPA activate YAP/TAZ and induce NUAK2 expression. YAP/TAZ phosphorylation status was monitored using Phos-Tag gels, while NUAK2 and ANKRD1 mRNA expression was determined by qPCR at the indicated times. Expression data are plotted as the mean +/- SD (n = 3). Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41467-018-05939-2), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/NUAK2-Antibody-Western-Blot-NBP1-81880-img0017.jpg "Western Blot: NUAK2 Antibody [NBP1-81880] - NUAK2 activity is involved in serum-induced or LPA-induced YAP/TAZ dephosphorylation and activation. FBS and LPA activate YAP/TAZ and induce NUAK2 expression. YAP/TAZ phosphorylation status was monitored using Phos-Tag gels, while NUAK2 and ANKRD1 mRNA expression was determined by qPCR at the indicated times. Expression data are plotted as the mean +/- SD (n = 3). Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41467-018-05939-2), licensed under a CC-BY license.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DPKEQKPPQASGLLLHRKGILKLNGKFSQTALELAAPTTFGSLDELAPPRPLARASRPSGAVSEDSILSSESFDQLDLPERLPEPPLRGCVSVDNLTGLEEPPSEGPGSCLRRWRQDPLGDSCFSLTDCQEVTATYRQALRVCSKLT |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NUAK2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot ARK5/NUAK1 Antibody (715901) [Unconjugated]](https://images.novusbio.com/images2/ARK5_MAB6978_Western_Blot_11262.jpg)
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for NUAK2 Antibody (NBP1-81880)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: NUAK2 Antibody [NBP1-81880] - Staining of human cell line U-251 MG shows localization to nucleoplasm, nucleoli fibrillar center & cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/NUAK2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-81880-img0010.jpg "Immunocytochemistry/Immunofluorescence: NUAK2 Antibody [NBP1-81880] - Staining of human cell line U-251 MG shows localization to nucleoplasm, nucleoli fibrillar center & cytosol. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: NUAK2 Antibody [NBP1-81880] - Staining of human testis shows moderate to strong cytoplasmic and nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/NUAK2-Antibody-Immunohistochemistry-Paraffin-NBP1-81880-img0015.jpg "Immunohistochemistry-Paraffin: NUAK2 Antibody [NBP1-81880] - Staining of human testis shows moderate to strong cytoplasmic and nuclear positivity in cells in seminiferous ducts.")
![Western Blot: NUAK2 Antibody [NBP1-81880] - Analysis in control (vector only transfected HEK293T lysate) and NUAK2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/NUAK2-Antibody-Western-Blot-NBP1-81880-img0011.jpg "Western Blot: NUAK2 Antibody [NBP1-81880] - Analysis in control (vector only transfected HEK293T lysate) and NUAK2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
![Immunohistochemistry-Paraffin: NUAK2 Antibody [NBP1-81880] - Staining of human cerebellum shows strong membranous positivity in Purkinje cells.](http://images.novusbio.com/fullsize/NUAK2-Antibody-Immunohistochemistry-Paraffin-NBP1-81880-img0012.jpg "Immunohistochemistry-Paraffin: NUAK2 Antibody [NBP1-81880] - Staining of human cerebellum shows strong membranous positivity in Purkinje cells.")
![Immunohistochemistry-Paraffin: NUAK2 Antibody [NBP1-81880] - Staining of human cervix shows strong nuclear positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/NUAK2-Antibody-Immunohistochemistry-Paraffin-NBP1-81880-img0013.jpg "Immunohistochemistry-Paraffin: NUAK2 Antibody [NBP1-81880] - Staining of human cervix shows strong nuclear positivity in squamous epithelial cells.")
![Immunohistochemistry-Paraffin: NUAK2 Antibody [NBP1-81880] - Staining of human duodenum shows moderate to strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/NUAK2-Antibody-Immunohistochemistry-Paraffin-NBP1-81880-img0014.jpg "Immunohistochemistry-Paraffin: NUAK2 Antibody [NBP1-81880] - Staining of human duodenum shows moderate to strong nuclear positivity in glandular cells.")
![Knockdown Validated: NUAK2 Antibody [NBP1-81880] - NUAK2 regulates YAP/TAZ activity through LATS. NUAK2 requires LATS to regulate YAP/TAZ localization, phosphorylation, and target gene expression in MDA-MB231 cells. YAP/TAZ phosphorylation was monitored using Phos-Tag gels. Relative phosphorylation levels from blots is quantitated (right). Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41467-018-05939-2), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/NUAK2-Antibody-Knockdown-Validated-NBP1-81880-img0016.jpg "Knockdown Validated: NUAK2 Antibody [NBP1-81880] - NUAK2 regulates YAP/TAZ activity through LATS. NUAK2 requires LATS to regulate YAP/TAZ localization, phosphorylation, and target gene expression in MDA-MB231 cells. YAP/TAZ phosphorylation was monitored using Phos-Tag gels. Relative phosphorylation levels from blots is quantitated (right). Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41467-018-05939-2), licensed under a CC-BY license.")
![Western Blot: NUAK2 Antibody [NBP1-81880] - NUAK2 activity is involved in serum-induced or LPA-induced YAP/TAZ dephosphorylation & activation. a, b FBS & LPA activate YAP/TAZ & induce NUAK2 expression. YAP/TAZ phosphorylation status was monitored using Phos-Tag gels (a), while NUAK2 & ANKRD1 mRNA expression was determined by qPCR at the indicated times. Expression data are plotted as the mean ± SD (n = 3). c–h WZ4003 (10 μM) blocks serum/LPA-induced NUAK2 & ANKRD1 mRNA expression. FBS-induced or LPA-induced YAP/TAZ dephosphorylation (e & g), or NUAK2 & ANKRD1 mRNA expression (c, f, h) was monitored at the indicated times (d). Expression data are plotted as the mean ± range for a representative experiment (c, f, h) Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30158528), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-81880_rabbit-polyclonal-nuak2-antibody-31020241535685.jpg "Western Blot: NUAK2 Antibody [NBP1-81880] - NUAK2 activity is involved in serum-induced or LPA-induced YAP/TAZ dephosphorylation & activation. a, b FBS & LPA activate YAP/TAZ & induce NUAK2 expression. YAP/TAZ phosphorylation status was monitored using Phos-Tag gels (a), while NUAK2 & ANKRD1 mRNA expression was determined by qPCR at the indicated times. Expression data are plotted as the mean ± SD (n = 3). c–h WZ4003 (10 μM) blocks serum/LPA-induced NUAK2 & ANKRD1 mRNA expression. FBS-induced or LPA-induced YAP/TAZ dephosphorylation (e & g), or NUAK2 & ANKRD1 mRNA expression (c, f, h) was monitored at the indicated times (d). Expression data are plotted as the mean ± range for a representative experiment (c, f, h) Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30158528), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: NUAK2 Antibody [NBP1-81880] - NUAK2 regulates YAP/TAZ activity through LATS. a Loss of NUAK2 enhances YAP/TAZ phosphorylation in MDA-MB231 cells. Quantitation of relative phosphorylation levels from blots is shown. b NUAK2 interacts with LATS1 & LATS2, but not MST1, MST2, or TAZ in the LUMIER protein interaction screen. c Lysates from HEK293T cells, transfected with NUAK2-Flag, were subjected to immunoprecipitation (IP) using anti-LATS1 antibody for endogenous LATS1 & co-immunoprecipitated NUAK2-Flag was detected by immunoblotting. Protein expression levels were confirmed (Totals). WT wild type, KR K81R, kinase dead. d–f NUAK2 requires LATS to regulate YAP/TAZ localization, phosphorylation, & target gene expression in MDA-MB231 cells. d YAP/TAZ localization was quantitated & plotted as the mean ± SD (n = 3) with representative images shown on the right. Scale bars, 25 μm. N: nuclear, C: cytoplasmic. e Target gene expression was determined by qPCR. Data are plotted as the mean ± SD (n = 3). f YAP/TAZ phosphorylation was monitored using Phos-Tag gels. Relative phosphorylation levels from blots is quantitated (right) Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30158528), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-81880_rabbit-polyclonal-nuak2-antibody-31020241612198.jpg "Western Blot: NUAK2 Antibody [NBP1-81880] - NUAK2 regulates YAP/TAZ activity through LATS. a Loss of NUAK2 enhances YAP/TAZ phosphorylation in MDA-MB231 cells. Quantitation of relative phosphorylation levels from blots is shown. b NUAK2 interacts with LATS1 & LATS2, but not MST1, MST2, or TAZ in the LUMIER protein interaction screen. c Lysates from HEK293T cells, transfected with NUAK2-Flag, were subjected to immunoprecipitation (IP) using anti-LATS1 antibody for endogenous LATS1 & co-immunoprecipitated NUAK2-Flag was detected by immunoblotting. Protein expression levels were confirmed (Totals). WT wild type, KR K81R, kinase dead. d–f NUAK2 requires LATS to regulate YAP/TAZ localization, phosphorylation, & target gene expression in MDA-MB231 cells. d YAP/TAZ localization was quantitated & plotted as the mean ± SD (n = 3) with representative images shown on the right. Scale bars, 25 μm. N: nuclear, C: cytoplasmic. e Target gene expression was determined by qPCR. Data are plotted as the mean ± SD (n = 3). f YAP/TAZ phosphorylation was monitored using Phos-Tag gels. Relative phosphorylation levels from blots is quantitated (right) Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30158528), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: NUAK2 Antibody [NBP1-81880] - NUAK2 regulates YAP/TAZ activity through LATS. a Loss of NUAK2 enhances YAP/TAZ phosphorylation in MDA-MB231 cells. Quantitation of relative phosphorylation levels from blots is shown. b NUAK2 interacts with LATS1 & LATS2, but not MST1, MST2, or TAZ in the LUMIER protein interaction screen. c Lysates from HEK293T cells, transfected with NUAK2-Flag, were subjected to immunoprecipitation (IP) using anti-LATS1 antibody for endogenous LATS1 & co-immunoprecipitated NUAK2-Flag was detected by immunoblotting. Protein expression levels were confirmed (Totals). WT wild type, KR K81R, kinase dead. d–f NUAK2 requires LATS to regulate YAP/TAZ localization, phosphorylation, & target gene expression in MDA-MB231 cells. d YAP/TAZ localization was quantitated & plotted as the mean ± SD (n = 3) with representative images shown on the right. Scale bars, 25 μm. N: nuclear, C: cytoplasmic. e Target gene expression was determined by qPCR. Data are plotted as the mean ± SD (n = 3). f YAP/TAZ phosphorylation was monitored using Phos-Tag gels. Relative phosphorylation levels from blots is quantitated (right) Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30158528), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-81880_rabbit-polyclonal-nuak2-antibody-310202416113541.jpg "Western Blot: NUAK2 Antibody [NBP1-81880] - NUAK2 regulates YAP/TAZ activity through LATS. a Loss of NUAK2 enhances YAP/TAZ phosphorylation in MDA-MB231 cells. Quantitation of relative phosphorylation levels from blots is shown. b NUAK2 interacts with LATS1 & LATS2, but not MST1, MST2, or TAZ in the LUMIER protein interaction screen. c Lysates from HEK293T cells, transfected with NUAK2-Flag, were subjected to immunoprecipitation (IP) using anti-LATS1 antibody for endogenous LATS1 & co-immunoprecipitated NUAK2-Flag was detected by immunoblotting. Protein expression levels were confirmed (Totals). WT wild type, KR K81R, kinase dead. d–f NUAK2 requires LATS to regulate YAP/TAZ localization, phosphorylation, & target gene expression in MDA-MB231 cells. d YAP/TAZ localization was quantitated & plotted as the mean ± SD (n = 3) with representative images shown on the right. Scale bars, 25 μm. N: nuclear, C: cytoplasmic. e Target gene expression was determined by qPCR. Data are plotted as the mean ± SD (n = 3). f YAP/TAZ phosphorylation was monitored using Phos-Tag gels. Relative phosphorylation levels from blots is quantitated (right) Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30158528), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: NUAK2 Antibody [NBP1-81880] - NUAK2 is associated with high-grade human bladder cancer. a, c Expression of NUAK2 & the YAP Signature Genes (YAP SG) is enhanced both in high-grade non-muscle-invasive (HG-NMIBC; n = 13, **p = 0.0071) & muscle-invasive (pT2 MIBC; n = 9, **p = 0.0033) bladder cancers39 as compared to LG-NMIBC (n = 27) using an unpaired t test. b Elevated expression of NUAK2 is correlated with disease recurrence in a cohort41 of MIBC patient samples with n = 57 disease free & n = 56, recurred samples (*p = 0.0172). Box & whisker plots show the median (line in the box), first & third quartiles (lower & upper ends of the box), & the minimum & maximum values (whiskers in the plot). Dots represent a single patient sample. d A heat map depicting expression of NUAK2 & YAP SG in NMIBC LG (open circle), HG (closed circle), & MIBC pT2 (slashed circle) bladder cancer samples39. e Characterization of high-grade-derived & low-grade-derived bladder cancer cell lines. Scale bar, 25 μm. f NUAK2 mRNA expression is elevated in HG-derived (TCCSUP & T24) BC cell lines as compared to LG lines. Data are plotted as the mean ± SD (n = 3). g–i Blocking NUAK2 activity with 10 μM WZ4003 (g) or NUAK2 expression in stable clones (#5 or #7) using inducible NUAK2 shRNAs (h, i) inhibits the growth of HG BC cell lines as measured by SRB (g) or DAPI (h) staining. Data are plotted as the mean ± SD of a representative experiment, n = 3 (for TCC) or mean ± range of two experiments (for T24) Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30158528), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-81880_rabbit-polyclonal-nuak2-antibody-310202416114727.jpg "Western Blot: NUAK2 Antibody [NBP1-81880] - NUAK2 is associated with high-grade human bladder cancer. a, c Expression of NUAK2 & the YAP Signature Genes (YAP SG) is enhanced both in high-grade non-muscle-invasive (HG-NMIBC; n = 13, **p = 0.0071) & muscle-invasive (pT2 MIBC; n = 9, **p = 0.0033) bladder cancers39 as compared to LG-NMIBC (n = 27) using an unpaired t test. b Elevated expression of NUAK2 is correlated with disease recurrence in a cohort41 of MIBC patient samples with n = 57 disease free & n = 56, recurred samples (*p = 0.0172). Box & whisker plots show the median (line in the box), first & third quartiles (lower & upper ends of the box), & the minimum & maximum values (whiskers in the plot). Dots represent a single patient sample. d A heat map depicting expression of NUAK2 & YAP SG in NMIBC LG (open circle), HG (closed circle), & MIBC pT2 (slashed circle) bladder cancer samples39. e Characterization of high-grade-derived & low-grade-derived bladder cancer cell lines. Scale bar, 25 μm. f NUAK2 mRNA expression is elevated in HG-derived (TCCSUP & T24) BC cell lines as compared to LG lines. Data are plotted as the mean ± SD (n = 3). g–i Blocking NUAK2 activity with 10 μM WZ4003 (g) or NUAK2 expression in stable clones (#5 or #7) using inducible NUAK2 shRNAs (h, i) inhibits the growth of HG BC cell lines as measured by SRB (g) or DAPI (h) staining. Data are plotted as the mean ± SD of a representative experiment, n = 3 (for TCC) or mean ± range of two experiments (for T24) Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30158528), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: NUAK2 Antibody [NBP1-81880] - NUAK2 regulates YAP/TAZ activity through LATS. a Loss of NUAK2 enhances YAP/TAZ phosphorylation in MDA-MB231 cells. Quantitation of relative phosphorylation levels from blots is shown. b NUAK2 interacts with LATS1 & LATS2, but not MST1, MST2, or TAZ in the LUMIER protein interaction screen. c Lysates from HEK293T cells, transfected with NUAK2-Flag, were subjected to immunoprecipitation (IP) using anti-LATS1 antibody for endogenous LATS1 & co-immunoprecipitated NUAK2-Flag was detected by immunoblotting. Protein expression levels were confirmed (Totals). WT wild type, KR K81R, kinase dead. d–f NUAK2 requires LATS to regulate YAP/TAZ localization, phosphorylation, & target gene expression in MDA-MB231 cells. d YAP/TAZ localization was quantitated & plotted as the mean ± SD (n = 3) with representative images shown on the right. Scale bars, 25 μm. N: nuclear, C: cytoplasmic. e Target gene expression was determined by qPCR. Data are plotted as the mean ± SD (n = 3). f YAP/TAZ phosphorylation was monitored using Phos-Tag gels. Relative phosphorylation levels from blots is quantitated (right) Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30158528), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-81880_rabbit-polyclonal-nuak2-antibody-31020241612229.jpg "Western Blot: NUAK2 Antibody [NBP1-81880] - NUAK2 regulates YAP/TAZ activity through LATS. a Loss of NUAK2 enhances YAP/TAZ phosphorylation in MDA-MB231 cells. Quantitation of relative phosphorylation levels from blots is shown. b NUAK2 interacts with LATS1 & LATS2, but not MST1, MST2, or TAZ in the LUMIER protein interaction screen. c Lysates from HEK293T cells, transfected with NUAK2-Flag, were subjected to immunoprecipitation (IP) using anti-LATS1 antibody for endogenous LATS1 & co-immunoprecipitated NUAK2-Flag was detected by immunoblotting. Protein expression levels were confirmed (Totals). WT wild type, KR K81R, kinase dead. d–f NUAK2 requires LATS to regulate YAP/TAZ localization, phosphorylation, & target gene expression in MDA-MB231 cells. d YAP/TAZ localization was quantitated & plotted as the mean ± SD (n = 3) with representative images shown on the right. Scale bars, 25 μm. N: nuclear, C: cytoplasmic. e Target gene expression was determined by qPCR. Data are plotted as the mean ± SD (n = 3). f YAP/TAZ phosphorylation was monitored using Phos-Tag gels. Relative phosphorylation levels from blots is quantitated (right) Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30158528), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot AMPK alpha 2 Antibody [Unconjugated]](https://images.novusbio.com/images2/AMPK_alpha_2_AF2850_Western_Blot_5219.jpg)
![Simple Western AMPK alpha 2 Antibody [Unconjugated]](https://images.novusbio.com/images2/AMPK_alpha_2_AF2850_Simple_Western_16678.jpg)
![Immunocytochemistry AMPK alpha 2 Antibody [Unconjugated]](https://images.novusbio.com/images2/AMPK_alpha_2_AF2850_Immunocytochemistry__Immunofluorescence_19686.jpg)
![Western Blot AMPK beta 1 Antibody [Unconjugated]](https://images.novusbio.com/images2/AMPK_beta_1_AF2854_Western_Blot_5220.jpg)
![Immunohistochemistry AMPK beta 1 Antibody [Unconjugated]](https://images.novusbio.com/images/af2854_human-mouse-rat-ampk-beta-1-affinity-purified-polyclonal-ab-immunohistochemistry-252023124938.jpg)
![Immunohistochemistry AMPK beta 1 Antibody [Unconjugated]](https://images.novusbio.com/images/af2854_human-mouse-rat-ampk-beta-1-affinity-purified-polyclonal-ab-immunohistochemistry-252023125022.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![Western Blot MARK2 [p Thr595] Antibody](https://images.novusbio.com/images/nbp1-78028_rabbit-polyclonal-mark2-p-thr595-antibody-255202313135151.jpg)
![Western Blot MARK2 [p Thr595] Antibody](https://images.novusbio.com/images/MARK2-[p-Thr595]-Antibody-Western-Blot-NBP1-78028-img0001.jpg)
![Western Blot MARK2 [p Thr595] Antibody](https://images.novusbio.com/images/MARK2-[p-Thr595]-Antibody-Western-Blot-NBP1-78028-img0002.jpg)
![Fas Ligand/TNFSF6 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Fas Ligand/TNFSF6 [Unconjugated]")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")